(data stored in ACNUC7421 zone)

EMBL: CP000947.PE4

CP000947.PE4         Location/Qualifiers
FT   CDS             complement(3895..4539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0004"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: hso:HS_0139 catabolite gene activator (cAMP
FT                   receptor protein)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32040"
FT                   /db_xref="GOA:B0UUM1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUM1"
FT                   /protein_id="ACA32040.1"
FT                   /translation="MLEQQGQSAPSMDPTLEWFLSHCHIHKYSAKSSLIHAGEKAETLY
FT                   YLIRGSVAVMVKDEEGKEMILTYLSQGDFFGEAGLFDETQPRSAWVKAKSSCEIAEISY
FT                   KKFRQLIQVNPEILMYLAGQLAHRLQNTSKQVSNLAFLDVTGRIAQTLLNLAKMPDAMT
FT                   HPDGMQIKITRQEIGQMVGCSRETVGRILKMLEDQHLISAHGKTIVVYGTR"
     MLEQQGQSAP SMDPTLEWFL SHCHIHKYSA KSSLIHAGEK AETLYYLIRG SVAVMVKDEE        60
     GKEMILTYLS QGDFFGEAGL FDETQPRSAW VKAKSSCEIA EISYKKFRQL IQVNPEILMY       120
     LAGQLAHRLQ NTSKQVSNLA FLDVTGRIAQ TLLNLAKMPD AMTHPDGMQI KITRQEIGQM       180
     VGCSRETVGR ILKMLEDQHL ISAHGKTIVV YGTR                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page