(data stored in ACNUC7421 zone)

EMBL: CP000947.PE41

CP000947.PE41        Location/Qualifiers
FT   CDS             32341..33600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0041"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   hso:HS_0174 ATP-dependent RNA helicase, DEAD box family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32052"
FT                   /db_xref="GOA:B0UUZ9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUZ9"
FT                   /protein_id="ACA32052.1"
FT                   /translation="MQNSHLSQQRFSDLALHRIVQQAIKEKGFEFCTPIQALSLPITLK
FT                   GQDIAGQAQTGTGKTIAFLTATFHHLLQKNNINSSEQPRALILAPTRELVVQIANDANF
FT                   LVQATGLKTGLAYGGEGYDKQLKVIDRGIDILIGTTGRVIDYVKQGIIRLDYIQVVVLD
FT                   EADRMFDLGFIRDIRYLLRKCPVPQQRLTMLFSATLSYKVRELAFEHMNDPQYVEIEPL
FT                   QKTGHRIREELFYPSNQDKMALLMTLLEEEWPERCIIFSNTKHRCEEIWGYLSADGHRV
FT                   GLLTGDVMQKKRLSLLKQFTDGTLDVLVATDVAARGLHIPDVTHVFNYDLPDDCEDYVH
FT                   RIGRTGRAGESGISISFACEEYAINLPAIEEYIGHSIPVSQYDAKALIEDLPTPHRIKR
FT                   GAFDSRSNLQRTVKRLKKTY"
     MQNSHLSQQR FSDLALHRIV QQAIKEKGFE FCTPIQALSL PITLKGQDIA GQAQTGTGKT        60
     IAFLTATFHH LLQKNNINSS EQPRALILAP TRELVVQIAN DANFLVQATG LKTGLAYGGE       120
     GYDKQLKVID RGIDILIGTT GRVIDYVKQG IIRLDYIQVV VLDEADRMFD LGFIRDIRYL       180
     LRKCPVPQQR LTMLFSATLS YKVRELAFEH MNDPQYVEIE PLQKTGHRIR EELFYPSNQD       240
     KMALLMTLLE EEWPERCIIF SNTKHRCEEI WGYLSADGHR VGLLTGDVMQ KKRLSLLKQF       300
     TDGTLDVLVA TDVAARGLHI PDVTHVFNYD LPDDCEDYVH RIGRTGRAGE SGISISFACE       360
     EYAINLPAIE EYIGHSIPVS QYDAKALIED LPTPHRIKRG AFDSRSNLQR TVKRLKKTY        419
//

If you have problems or comments...

PBIL Back to PBIL home page