(data stored in ACNUC7421 zone)

EMBL: CP000947.PE43

CP000947.PE43        Location/Qualifiers
FT   CDS             34397..35071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0043"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase ;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   hso:HS_0176 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32074"
FT                   /db_xref="GOA:B0UV01"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV01"
FT                   /protein_id="ACA32074.1"
FT                   /translation="MTQFKLIGFDLDGTLVNSLPDLALSINSALKDVNLPQASENLVMT
FT                   WIGNGADVLSQRAVDWACTQAEKELTEDEFKYFKRQFGFYYGENLCNISRLYPNVKETL
FT                   EALKAQGYILAVVTNKPTKHVQPILTAFGIDHLFSEMLGGQSLPEIKPHPAPFYYLCGK
FT                   FGLYPKQILFVGDSQNDIFAAHSAGCAVVGLTYGYNYNIPIAQSKPDWIFDDFADILKI
FT                   TQ"
     MTQFKLIGFD LDGTLVNSLP DLALSINSAL KDVNLPQASE NLVMTWIGNG ADVLSQRAVD        60
     WACTQAEKEL TEDEFKYFKR QFGFYYGENL CNISRLYPNV KETLEALKAQ GYILAVVTNK       120
     PTKHVQPILT AFGIDHLFSE MLGGQSLPEI KPHPAPFYYL CGKFGLYPKQ ILFVGDSQND       180
     IFAAHSAGCA VVGLTYGYNY NIPIAQSKPD WIFDDFADIL KITQ                        224
//

If you have problems or comments...

PBIL Back to PBIL home page