(data stored in ACNUC7421 zone)

EMBL: CP000947.PE45

CP000947.PE45        Location/Qualifiers
FT   CDS             complement(36303..36686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32093"
FT                   /db_xref="GOA:B0UV03"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV03"
FT                   /protein_id="ACA32093.1"
FT                   /translation="MKFMLIQQRLIFLVQRHLIDEDIMTITLNIRNRLGKKWRVNLKTK
FT                   QVDMLLIHLAMALGRIKRGYVAKALNPDFFSEIERAVCFTKILKLHQELLTFIPFPVPK
FT                   EEQSHFIANIYSLSLAQPWILTP"
     MKFMLIQQRL IFLVQRHLID EDIMTITLNI RNRLGKKWRV NLKTKQVDML LIHLAMALGR        60
     IKRGYVAKAL NPDFFSEIER AVCFTKILKL HQELLTFIPF PVPKEEQSHF IANIYSLSLA       120
     QPWILTP                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page