(data stored in ACNUC7421 zone)

EMBL: CP000947.PE46

CP000947.PE46        Location/Qualifiers
FT   CDS             36796..37398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0046"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; beta-phosphoglucomutase family hydrolase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   hso:HS_0179 possible phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32104"
FT                   /db_xref="GOA:B0UV04"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV04"
FT                   /protein_id="ACA32104.1"
FT                   /translation="MLNKEIIARYEGLIFDMDGTVIDTMPCHKQAWELVGAEMGYALDG
FT                   DVMYQLGGAPVRTIAKAIMEKAQMPLYLMEDVISLKRKYGIELIMKNATLLPAADIVKQ
FT                   YVGQKPLALGTGSHRYVTEMLLEKFQLQSYFGAIVTAEDVINHKPEPDTFLRCAELLNL
FT                   DPLKCLVFEDADLGVQAGLAAEMDVFDVRVNQIITSK"
     MLNKEIIARY EGLIFDMDGT VIDTMPCHKQ AWELVGAEMG YALDGDVMYQ LGGAPVRTIA        60
     KAIMEKAQMP LYLMEDVISL KRKYGIELIM KNATLLPAAD IVKQYVGQKP LALGTGSHRY       120
     VTEMLLEKFQ LQSYFGAIVT AEDVINHKPE PDTFLRCAEL LNLDPLKCLV FEDADLGVQA       180
     GLAAEMDVFD VRVNQIITSK                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page