(data stored in ACNUC7421 zone)

EMBL: CP000947.PE47

CP000947.PE47        Location/Qualifiers
FT   CDS             complement(37776..40529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0047"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: hso:HS_0181 TonB-dependent outer
FT                   membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32115"
FT                   /db_xref="GOA:B0UV05"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV05"
FT                   /protein_id="ACA32115.1"
FT                   /translation="MMTNKFKLTAVAFSVLSTCVYAEEMLDQINVEYKLPPKQEVFKKA
FT                   GATSVRENISTSTQSIDDIIRTVPGAFTNLDKSSGTVSVNVRGQTGFGRVNTMVDGISQ
FT                   TFFATSGDNSEKAGGTSQFGATIDPAFITSVDIQRGSFDGKAGANALVGSANFRTIGVD
FT                   DVISEGRNVGALLNVGGGTNATGPNYMGAVAFRYPFSDTRTLGFMYAYSWRKSSQDFKV
FT                   GGGRSIKDVDAEEVGRIVEEACKGEAFCDRNEKRKLYGLQPYDPSKLLHYPQSHLAKIE
FT                   YNDKYNKAILSYRSLSTALSGRNLENKNYQLNYQLKPKENLQFELILADNTSTQTYHKG
FT                   SVFNGKMLKDVLESKNSAKTTDINMHFSIPFTEKFSYEATLGANILKNKYSKNRHPREL
FT                   GYYFDGGEPNSLDACDEVGKYKNACKYHGIRSNTFQPDGEQRFKTLYFDQTFKYDIYTL
FT                   KVNANRQIYKYEGRIFPLDPKDRFSSRTWHDSHKKMKNGKPIWVNSNSSEIVAKYGVEE
FT                   AEKLGCYTGPNDDDTTWDVYNCPSFYSVHKGDSRSHDNYSMSFSADFHPLFSPFVSYAK
FT                   THRVPNIKEMYFSEFGTLAIRPDLKSEKAKTIQFGINGYKNGIFSDFDALGFKILAYQT
FT                   KIRDYIINIKQECSSNAWRGSNKAPTIYDCVEHLTHINYEGGKTILKTDLVDTGDGKTK
FT                   VPSNQLIPADSSPIVKIQGLELELNYDIGWFYANLSYARQKTNQPSSFSDSSYNVSDDS
FT                   ETGQYLQGFGLSKISSLPKDYGSLDLGTRLFDGKLTLGGTAKYYGKSKRARLDKADGDV
FT                   ILPGTFTSRKTGETFLTYVRISGTEEIKAQPIIFDFYAIYQPTENLTIKGEIQNAFDKK
FT                   YINPLDANNDSANQMTYAMGVGDGYQKALNNYSKGRTFVLNVNYKF"
     MMTNKFKLTA VAFSVLSTCV YAEEMLDQIN VEYKLPPKQE VFKKAGATSV RENISTSTQS        60
     IDDIIRTVPG AFTNLDKSSG TVSVNVRGQT GFGRVNTMVD GISQTFFATS GDNSEKAGGT       120
     SQFGATIDPA FITSVDIQRG SFDGKAGANA LVGSANFRTI GVDDVISEGR NVGALLNVGG       180
     GTNATGPNYM GAVAFRYPFS DTRTLGFMYA YSWRKSSQDF KVGGGRSIKD VDAEEVGRIV       240
     EEACKGEAFC DRNEKRKLYG LQPYDPSKLL HYPQSHLAKI EYNDKYNKAI LSYRSLSTAL       300
     SGRNLENKNY QLNYQLKPKE NLQFELILAD NTSTQTYHKG SVFNGKMLKD VLESKNSAKT       360
     TDINMHFSIP FTEKFSYEAT LGANILKNKY SKNRHPRELG YYFDGGEPNS LDACDEVGKY       420
     KNACKYHGIR SNTFQPDGEQ RFKTLYFDQT FKYDIYTLKV NANRQIYKYE GRIFPLDPKD       480
     RFSSRTWHDS HKKMKNGKPI WVNSNSSEIV AKYGVEEAEK LGCYTGPNDD DTTWDVYNCP       540
     SFYSVHKGDS RSHDNYSMSF SADFHPLFSP FVSYAKTHRV PNIKEMYFSE FGTLAIRPDL       600
     KSEKAKTIQF GINGYKNGIF SDFDALGFKI LAYQTKIRDY IINIKQECSS NAWRGSNKAP       660
     TIYDCVEHLT HINYEGGKTI LKTDLVDTGD GKTKVPSNQL IPADSSPIVK IQGLELELNY       720
     DIGWFYANLS YARQKTNQPS SFSDSSYNVS DDSETGQYLQ GFGLSKISSL PKDYGSLDLG       780
     TRLFDGKLTL GGTAKYYGKS KRARLDKADG DVILPGTFTS RKTGETFLTY VRISGTEEIK       840
     AQPIIFDFYA IYQPTENLTI KGEIQNAFDK KYINPLDANN DSANQMTYAM GVGDGYQKAL       900
     NNYSKGRTFV LNVNYKF                                                      917
//

If you have problems or comments...

PBIL Back to PBIL home page