(data stored in ACNUC7421 zone)

EMBL: CP000947.PE48

CP000947.PE48        Location/Qualifiers
FT   CDS             complement(40762..41379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0048"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   hso:HS_0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32126"
FT                   /db_xref="GOA:B0UV06"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV06"
FT                   /protein_id="ACA32126.1"
FT                   /translation="MLSVFNFIDLLGTFIFALSGAVAGVKKQFDLFGVFVVSAVTAIGG
FT                   GIIRDLCLSATPPAGLENIAYLLIILLAVCCVSFFQEKITSFSKVSNLLDAVGLGFFAA
FT                   FGANKTWYMTENIQLSIILGCISAVGGGCIRDVLTNKSPLIFQSEIYAGAAIVGATIEL
FT                   LGSTGLISPLLSPWLAIITCTLIRMLAIKYRIQFPFIKDKSL"
     MLSVFNFIDL LGTFIFALSG AVAGVKKQFD LFGVFVVSAV TAIGGGIIRD LCLSATPPAG        60
     LENIAYLLII LLAVCCVSFF QEKITSFSKV SNLLDAVGLG FFAAFGANKT WYMTENIQLS       120
     IILGCISAVG GGCIRDVLTN KSPLIFQSEI YAGAAIVGAT IELLGSTGLI SPLLSPWLAI       180
     ITCTLIRMLA IKYRIQFPFI KDKSL                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page