(data stored in ACNUC7421 zone)

EMBL: CP000947.PE49

CP000947.PE49        Location/Qualifiers
FT   CDS             41621..43156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0049"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Threonine dehydratase domain protein;
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: hso:HS_0183 threonine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32137"
FT                   /db_xref="GOA:B0UV07"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV07"
FT                   /protein_id="ACA32137.1"
FT                   /translation="MISNLTEQPSGAEYLKAILSSKIYELAQVTPLQPMLKLSERLSNT
FT                   VLVKREDRQLVHSFKLRGAYAMIAGLSQPQKNAGVITASAGNHAQGVALSAKNLGLNAL
FT                   IVMPQNTPRIKVDAVRGYGGEVLLYGANFDEAKAKAIELSESKSMTFIPPFDHPAVIAG
FT                   QGSLAMELLQQNSHIDRIFVPVGGGGLAAGVAVLIKQLMPDIKVIAVESKDSACLHAAL
FT                   KVGQPVDLERVGLFADGVAVKRIGNETFRVCQQYIDDVVLVDSDEVCAAMKDMFENVRA
FT                   IAEPSGAVSLAGLKKYVKEHNIQGETLVNILSGANLNFHTLRYVSERCEIGEKHEAIFA
FT                   VTIPEEKGSFLRFCHLLGDRPVTEFNYRYADKEQACIFVGVRISSEKEKLEIIQQLEQN
FT                   DYKVMDLSDDEIAKTHIRYMIGGRTTSNSKERLYSFEFPEQKGALLKFLMMLGTHWNIS
FT                   LFHYRAYGADYGNVLAGFQLDEHDEIRFNGHLEELAYTYQDVTDSPAYKYFLA"
     MISNLTEQPS GAEYLKAILS SKIYELAQVT PLQPMLKLSE RLSNTVLVKR EDRQLVHSFK        60
     LRGAYAMIAG LSQPQKNAGV ITASAGNHAQ GVALSAKNLG LNALIVMPQN TPRIKVDAVR       120
     GYGGEVLLYG ANFDEAKAKA IELSESKSMT FIPPFDHPAV IAGQGSLAME LLQQNSHIDR       180
     IFVPVGGGGL AAGVAVLIKQ LMPDIKVIAV ESKDSACLHA ALKVGQPVDL ERVGLFADGV       240
     AVKRIGNETF RVCQQYIDDV VLVDSDEVCA AMKDMFENVR AIAEPSGAVS LAGLKKYVKE       300
     HNIQGETLVN ILSGANLNFH TLRYVSERCE IGEKHEAIFA VTIPEEKGSF LRFCHLLGDR       360
     PVTEFNYRYA DKEQACIFVG VRISSEKEKL EIIQQLEQND YKVMDLSDDE IAKTHIRYMI       420
     GGRTTSNSKE RLYSFEFPEQ KGALLKFLMM LGTHWNISLF HYRAYGADYG NVLAGFQLDE       480
     HDEIRFNGHL EELAYTYQDV TDSPAYKYFL A                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page