(data stored in ACNUC7421 zone)

EMBL: CP000947.PE5

CP000947.PE5         Location/Qualifiers
FT   CDS             complement(4552..4776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0005"
FT                   /product="protein of unknown function UPF0270"
FT                   /note="PFAM: protein of unknown function UPF0270; KEGG:
FT                   hso:HS_0140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32146"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUM2"
FT                   /protein_id="ACA32146.1"
FT                   /translation="MLIPWEKLEEQTLLNIVDSFILREGTDYGSTELSLAEKRENLFKN
FT                   IRQGKAILVWSELHQSIDIKNKMDFLNGK"
     MLIPWEKLEE QTLLNIVDSF ILREGTDYGS TELSLAEKRE NLFKNIRQGK AILVWSELHQ        60
     SIDIKNKMDF LNGK                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page