(data stored in ACNUC7421 zone)

EMBL: CP000947.PE50

CP000947.PE50        Location/Qualifiers
FT   CDS             complement(43200..44144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0050"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="TIGRFAM: hydroxymethylbutenyl pyrophosphate
FT                   reductase; PFAM: LytB protein; KEGG: hso:HS_0184
FT                   4-hydroxy-3-methylbut-2-enyl diphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32147"
FT                   /db_xref="GOA:B0UV08"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV08"
FT                   /protein_id="ACA32147.1"
FT                   /translation="MKIILANPRGFCAGVDRAISIVELALEIHGAPIYVRHEVVHNRFV
FT                   VNGLRERGAIFVEELDEVPNGAIVIFSAHGVSQAVRQEAKERNLKVFDATCPLVTKVHM
FT                   QVARASRKGTKAILIGHEGHPEVIGTMGQYDNDKGGIYLVEDVEDIAKLTLRNDEDITF
FT                   MTQTTLSIDDTAGVIEVLKQKYPAIQGPRKNDICYATTNRQQAVRELAKLSDLVIVVGS
FT                   KNSSNSNRLAELASRMGVTAKLIDDANDIEVSWLDNVTVIGLTAGASAPEILVQSVISR
FT                   LKELGVDKVEELEGCEENTVFEVPKELRIKEVE"
     MKIILANPRG FCAGVDRAIS IVELALEIHG APIYVRHEVV HNRFVVNGLR ERGAIFVEEL        60
     DEVPNGAIVI FSAHGVSQAV RQEAKERNLK VFDATCPLVT KVHMQVARAS RKGTKAILIG       120
     HEGHPEVIGT MGQYDNDKGG IYLVEDVEDI AKLTLRNDED ITFMTQTTLS IDDTAGVIEV       180
     LKQKYPAIQG PRKNDICYAT TNRQQAVREL AKLSDLVIVV GSKNSSNSNR LAELASRMGV       240
     TAKLIDDAND IEVSWLDNVT VIGLTAGASA PEILVQSVIS RLKELGVDKV EELEGCEENT       300
     VFEVPKELRI KEVE                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page