(data stored in ACNUC7421 zone)

EMBL: CP000947.PE53

CP000947.PE53        Location/Qualifiers
FT   CDS             45428..46420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0053"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: hso:HS_1548 outer membrane
FT                   protein P1"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32180"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV11"
FT                   /protein_id="ACA32180.1"
FT                   /translation="MNMNFSLRSKYKDDYVGGVLGGTSEMDSINLNLSGSYRVSKGLSV
FT                   GAGLNAIYAKAKFERRAGILKKTIDSLRSDDNELLILLSPSIVSSAYSLTFHENSTVAR
FT                   LQDNNAWGLGWNIGAVYEFNQDNRIGIAYHSKVDIDFKDNDTLGYILGKEEIKLHRAKG
FT                   KLTLHLPSYFEISGFHQLTAKFAMHYSYKYTQWSRLQSLHAAYSNGEVAFHKDENFHDS
FT                   SRVALGATYDVNDKLTLRAGIAYDESADHPTASIPDTDRTWYSLGATYHFTPNLSVDMG
FT                   FAHLRGKKQKFKENHSFTSKDNYEVGRIDADYQSTARANLYGLNLNYRF"
     MNMNFSLRSK YKDDYVGGVL GGTSEMDSIN LNLSGSYRVS KGLSVGAGLN AIYAKAKFER        60
     RAGILKKTID SLRSDDNELL ILLSPSIVSS AYSLTFHENS TVARLQDNNA WGLGWNIGAV       120
     YEFNQDNRIG IAYHSKVDID FKDNDTLGYI LGKEEIKLHR AKGKLTLHLP SYFEISGFHQ       180
     LTAKFAMHYS YKYTQWSRLQ SLHAAYSNGE VAFHKDENFH DSSRVALGAT YDVNDKLTLR       240
     AGIAYDESAD HPTASIPDTD RTWYSLGATY HFTPNLSVDM GFAHLRGKKQ KFKENHSFTS       300
     KDNYEVGRID ADYQSTARAN LYGLNLNYRF                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page