(data stored in ACNUC7421 zone)

EMBL: CP000947.PE55

CP000947.PE55        Location/Qualifiers
FT   CDS             complement(49399..49947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32200"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV13"
FT                   /protein_id="ACA32200.1"
FT                   /translation="MKKLKNLLLILGTFIPCLSFAQNIILDGYKDLKFGMTYQQIADSK
FT                   LCTGWEYYQPLNSYKCQHFLFNGNNREATAYFNGQVLNSIAIDILNYNQNRPPFPREVQ
FT                   EVKDILNGLPQKYGPPTKVVCGADYARSNEECNINTTDINFEDYWMVEFLNGQIRLVNS
FT                   VNQWVILVYSSAKTILDSL"
     MKKLKNLLLI LGTFIPCLSF AQNIILDGYK DLKFGMTYQQ IADSKLCTGW EYYQPLNSYK        60
     CQHFLFNGNN REATAYFNGQ VLNSIAIDIL NYNQNRPPFP REVQEVKDIL NGLPQKYGPP       120
     TKVVCGADYA RSNEECNINT TDINFEDYWM VEFLNGQIRL VNSVNQWVIL VYSSAKTILD       180
     SL                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page