(data stored in ACNUC7421 zone)

EMBL: CP000947.PE56

CP000947.PE56        Location/Qualifiers
FT   CDS             complement(50045..50989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0056"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /EC_number="2.7.7.2"
FT                   /EC_number="2.7.1.26"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF;
FT                   cytidyltransferase-related domain; PFAM: Riboflavin kinase
FT                   / FAD synthetase; KEGG: hso:HS_0188 bifunctional riboflavin
FT                   biosynthesis protein/riboflavin kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32211"
FT                   /db_xref="GOA:B0UV14"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV14"
FT                   /protein_id="ACA32211.1"
FT                   /translation="MQLIRGFHNLPEPLKQQGCAVTIGNFDGVHLGHQSILQHLKAKAK
FT                   QLNLPVVVMLFEPQPYEYFQGDQAPARLMRLRDKLAYLAQLGVDYVFCVKFNRTFAQLS
FT                   AEQFISDCLVKHLKMKFLSIGDDFRFGLNREGDFRLLQKKGQQQSFIVEDNRSLQLNDQ
FT                   RISSTAIRQALSEDNLALAEKLLGKPYRIYGRVAHGNKLGRTIGFPTANIYLHRQVNPI
FT                   KGVYVVKVRLKNGDIFQGVANIGKRPTINGVKQLLEVHLFNFDRDLYGQSLQIEFCHKI
FT                   RHEKKFPSLNALKNQIENDVVVAKKYFQQVLNL"
     MQLIRGFHNL PEPLKQQGCA VTIGNFDGVH LGHQSILQHL KAKAKQLNLP VVVMLFEPQP        60
     YEYFQGDQAP ARLMRLRDKL AYLAQLGVDY VFCVKFNRTF AQLSAEQFIS DCLVKHLKMK       120
     FLSIGDDFRF GLNREGDFRL LQKKGQQQSF IVEDNRSLQL NDQRISSTAI RQALSEDNLA       180
     LAEKLLGKPY RIYGRVAHGN KLGRTIGFPT ANIYLHRQVN PIKGVYVVKV RLKNGDIFQG       240
     VANIGKRPTI NGVKQLLEVH LFNFDRDLYG QSLQIEFCHK IRHEKKFPSL NALKNQIEND       300
     VVVAKKYFQQ VLNL                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page