(data stored in ACNUC7421 zone)

EMBL: CP000947.PE59

CP000947.PE59        Location/Qualifiers
FT   CDS             complement(52080..52868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0059"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   hso:HS_0191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32242"
FT                   /db_xref="GOA:B0UV17"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV17"
FT                   /protein_id="ACA32242.1"
FT                   /translation="MNTTEDNSSFRQREITRTCAQVAQMLLQHGAESTLIVQMAQRLGF
FT                   ALGIDSVECALTPNAVIITTLYDHNCITTVRKNLDKGINMQVVTEVQRLVIMAEKGLYD
FT                   LQQIRKKLDGIKPLKYNRFVVVTMIGLSCACFAHLSGGDIIVFLITFIASSIAMFIRQT
FT                   LALRHYNPLIVFAITAFVASMVAGLAVKYELGNDPQIALASSVLLLVPGFPLINSLADI
FT                   LKGHINMGIARWTLATVLTFGTCLGIVFALSFLHIANWGR"
     MNTTEDNSSF RQREITRTCA QVAQMLLQHG AESTLIVQMA QRLGFALGID SVECALTPNA        60
     VIITTLYDHN CITTVRKNLD KGINMQVVTE VQRLVIMAEK GLYDLQQIRK KLDGIKPLKY       120
     NRFVVVTMIG LSCACFAHLS GGDIIVFLIT FIASSIAMFI RQTLALRHYN PLIVFAITAF       180
     VASMVAGLAV KYELGNDPQI ALASSVLLLV PGFPLINSLA DILKGHINMG IARWTLATVL       240
     TFGTCLGIVF ALSFLHIANW GR                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page