(data stored in ACNUC7421 zone)

EMBL: CP000947.PE6

CP000947.PE6         Location/Qualifiers
FT   CDS             complement(4811..5470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0006"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: hso:HS_0141
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32253"
FT                   /db_xref="GOA:B0UUM3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUM3"
FT                   /protein_id="ACA32253.1"
FT                   /translation="MEQQQLDIGDAEIVVASKQKTQKIEKRTVKERRQQVLTVLTHMLH
FT                   SERGMERMTTARLAQEVGVSEAALYRYFPSKTKMFEALLDNIENTLFSRINHSIKNETN
FT                   TMNRVRDILQTILDFARKNPGLTRILTGHALMFEDSQLQARVARFFDRLELQFVNILQM
FT                   RKLREGKSFHLDEKIIASHLVTLCEGQFMRYVRNNFRHLPNQGFEQQWKLLESLFA"
     MEQQQLDIGD AEIVVASKQK TQKIEKRTVK ERRQQVLTVL THMLHSERGM ERMTTARLAQ        60
     EVGVSEAALY RYFPSKTKMF EALLDNIENT LFSRINHSIK NETNTMNRVR DILQTILDFA       120
     RKNPGLTRIL TGHALMFEDS QLQARVARFF DRLELQFVNI LQMRKLREGK SFHLDEKIIA       180
     SHLVTLCEGQ FMRYVRNNFR HLPNQGFEQQ WKLLESLFA                              219
//

If you have problems or comments...

PBIL Back to PBIL home page