(data stored in ACNUC7421 zone)

EMBL: CP000947.PE60

CP000947.PE60        Location/Qualifiers
FT   CDS             53026..54138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0060"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein; KEGG: hso:HS_0192 glutamate 5-kinase
FT                   (gamma-glutamyl kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32254"
FT                   /db_xref="GOA:B0UV18"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV18"
FT                   /protein_id="ACA32254.1"
FT                   /translation="METQKTNKTIVVKFGTSTLTQGSSKLNRPHMMEIVRQITQLHRAG
FT                   FRIIIVTSGAMAAGRHYLNHPQLPPTIASKQLLAAVGQSQLIQTWEQLFAIYDIHIGQI
FT                   LLTRADIEDRERFMNARDTLHALLDNRIIPVINENDAVATAEIKVGDNDNLSALVAILA
FT                   QAEQLYLLTDQRGLFDSDPRKNPQAKLISIVDKITDHIRSIAGGSGTTLGTGGMTTKIS
FT                   AADIATRSGVETIIAPGNLENVIVNLAYGKDIGTKFVVQTDRLESRKQWIFAAPVAGIV
FT                   TIDEGAESAVLIQHKSLLPAGIISVEGCFSRGEVVKICGSNGKKIALGVPRYNSDSLIQ
FT                   IKGKKSQDIEQILGYEYGSVAIHRDDMVVY"
     METQKTNKTI VVKFGTSTLT QGSSKLNRPH MMEIVRQITQ LHRAGFRIII VTSGAMAAGR        60
     HYLNHPQLPP TIASKQLLAA VGQSQLIQTW EQLFAIYDIH IGQILLTRAD IEDRERFMNA       120
     RDTLHALLDN RIIPVINEND AVATAEIKVG DNDNLSALVA ILAQAEQLYL LTDQRGLFDS       180
     DPRKNPQAKL ISIVDKITDH IRSIAGGSGT TLGTGGMTTK ISAADIATRS GVETIIAPGN       240
     LENVIVNLAY GKDIGTKFVV QTDRLESRKQ WIFAAPVAGI VTIDEGAESA VLIQHKSLLP       300
     AGIISVEGCF SRGEVVKICG SNGKKIALGV PRYNSDSLIQ IKGKKSQDIE QILGYEYGSV       360
     AIHRDDMVVY                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page