(data stored in ACNUC7421 zone)

EMBL: CP000947.PE61

CP000947.PE61        Location/Qualifiers
FT   CDS             complement(54299..54853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0061"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: transcription antitermination protein
FT                   NusG; KOW domain protein; SMART: NGN domain protein; KOW
FT                   (Kyrpides Ouzounis Woese) domain protein; KEGG: hso:HS_0193
FT                   transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32263"
FT                   /db_xref="GOA:B0UV19"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV19"
FT                   /protein_id="ACA32263.1"
FT                   /translation="MTENTAKKRWYVLQAFSGFEGRVAATLREYIKLHQMEEQFGEVLV
FT                   PTEEVVENVGGKRRKSERKYFPGYVLVQMEMNDYTWQLVRSVPRVMGFIGGTPDKPAPI
FT                   SQKEAERILNRVQETADKPRHRKEFQPGEEIRVTEGPFADFNGTVEEVDYDKGRLKVSV
FT                   LIFGRATPVELEFSQVEKANG"
     MTENTAKKRW YVLQAFSGFE GRVAATLREY IKLHQMEEQF GEVLVPTEEV VENVGGKRRK        60
     SERKYFPGYV LVQMEMNDYT WQLVRSVPRV MGFIGGTPDK PAPISQKEAE RILNRVQETA       120
     DKPRHRKEFQ PGEEIRVTEG PFADFNGTVE EVDYDKGRLK VSVLIFGRAT PVELEFSQVE       180
     KANG                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page