(data stored in ACNUC7421 zone)

EMBL: CP000947.PE62

CP000947.PE62        Location/Qualifiers
FT   CDS             complement(54855..55262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0062"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: hso:HS_0194 protein
FT                   export protein (preprotein translocase)"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32274"
FT                   /db_xref="GOA:B0UV20"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV20"
FT                   /protein_id="ACA32274.1"
FT                   /translation="MALEITKNKAAPEIEQKSKGLNGFLWLLVVAIVIVAAVSNIYLVE
FT                   KFSTALRVVGIVVALLIALGIAAITNQGMKARRFFSDSRIELRRITWPTRPEAMQTTLI
FT                   VFAVTVIASLILWGLDSVIVSLITFLTDLRF"
     MALEITKNKA APEIEQKSKG LNGFLWLLVV AIVIVAAVSN IYLVEKFSTA LRVVGIVVAL        60
     LIALGIAAIT NQGMKARRFF SDSRIELRRI TWPTRPEAMQ TTLIVFAVTV IASLILWGLD       120
     SVIVSLITFL TDLRF                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page