(data stored in ACNUC7421 zone)

EMBL: CP000947.PE63

CP000947.PE63        Location/Qualifiers
FT   CDS             complement(55438..56622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0063"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: hso:HS_1644
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32285"
FT                   /db_xref="GOA:B0UV21"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV21"
FT                   /protein_id="ACA32285.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLSKHFGGAAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTATRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPIVRGSALQALNGVAEWEEKILELASHLDNYIPEPERAIDQPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIRTGEEVEIVGIKETTKTTVTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKREEIERGQVLAKPGSITPHTDFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK"
     MSKEKFERTK PHVNVGTIGH VDHGKTTLTA AITTVLSKHF GGAARAFDQI DNAPEEKARG        60
     ITINTSHVEY DTATRHYAHV DCPGHADYVK NMITGAAQMD GAILVVAATD GPMPQTREHI       120
     LLGRQVGVPY IIVFLNKCDM VDDEELLELV EMEVRELLSQ YDFPGDDTPI VRGSALQALN       180
     GVAEWEEKIL ELASHLDNYI PEPERAIDQP FLLPIEDVFS ISGRGTVVTG RVERGIIRTG       240
     EEVEIVGIKE TTKTTVTGVE MFRKLLDEGR AGENIGALLR GTKREEIERG QVLAKPGSIT       300
     PHTDFESEVY VLSKEEGGRH TPFFKGYRPQ FYFRTTDVTG TIELPEGVEM VMPGDNIKMT       360
     VSLIHPIAMD QGLRFAIREG GRTVGAGVVA KIIK                                   394
//

If you have problems or comments...

PBIL Back to PBIL home page