(data stored in ACNUC7421 zone)

EMBL: CP000947.PE64

CP000947.PE64        Location/Qualifiers
FT   CDS             57327..58280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0064"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: pantothenate kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase; KEGG: hso:HS_0196
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32296"
FT                   /db_xref="GOA:B0UV22"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV22"
FT                   /protein_id="ACA32296.1"
FT                   /translation="MEELNTIKLSDHLTPFLTFNRQQWAELRKSVPLKLTEQDLKPLLG
FT                   FNEELSLEEVSTIYLPLARLINYYIEENLRRQTVLKRFLSGHNPKVPYIISIAGSVSVG
FT                   KSTSARILQSLLANWPVARKVDLITTDGFLYPLEILQKKNLLQKKGFPISYDTQRLIRF
FT                   LADIKSGKKNVKAPIYSHLTYDIIPNQFDIVDRPDILILEGLNVLQIGSNKSNQMFVSD
FT                   FVDFSIFVDAEEDQLKEWYIKRFLKFCRSAFTDPNSYFKHYANLSEQEAIETASQIWDN
FT                   INGLNLKQNILPTRERANLILKKGENHKVELVKLRK"
     MEELNTIKLS DHLTPFLTFN RQQWAELRKS VPLKLTEQDL KPLLGFNEEL SLEEVSTIYL        60
     PLARLINYYI EENLRRQTVL KRFLSGHNPK VPYIISIAGS VSVGKSTSAR ILQSLLANWP       120
     VARKVDLITT DGFLYPLEIL QKKNLLQKKG FPISYDTQRL IRFLADIKSG KKNVKAPIYS       180
     HLTYDIIPNQ FDIVDRPDIL ILEGLNVLQI GSNKSNQMFV SDFVDFSIFV DAEEDQLKEW       240
     YIKRFLKFCR SAFTDPNSYF KHYANLSEQE AIETASQIWD NINGLNLKQN ILPTRERANL       300
     ILKKGENHKV ELVKLRK                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page