(data stored in ACNUC7421 zone)

EMBL: CP000947.PE66

CP000947.PE66        Location/Qualifiers
FT   CDS             complement(59724..63200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0066"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: hso:HS_0198 DNA-directed DNA polymerase, alpha
FT                   subunit (DNA polymerase III, alpha subunit); TIGRFAM: DNA
FT                   polymerase III, alpha subunit; PFAM: PHP domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; DNA
FT                   polymerase III alpha subunit; SMART: phosphoesterase PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32318"
FT                   /db_xref="GOA:B0UV24"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV24"
FT                   /protein_id="ACA32318.1"
FT                   /translation="MSQPRFVHLRVHSDFSMINGITKVKPLIKACVQHEMVAMALTDFT
FT                   NFCGLVRFYGEAQSSGVKPIIGADVLVKSDLLGDELFELTLLAKNNEGYHNITLLLSKA
FT                   YERGYYNLPYIDQSWLAEHHEGIIILSGGRNGDVGKKLLKNNSADVETAVAFYQEYFPD
FT                   HFYLSLSRTGRSDEDRYIQSALILAQQKQLPLVATNDVCFLSPEDFEAHEIRVAIHDGY
FT                   TLDDPKRPKLYSSQQYFRSEQEMCELFADIPTALENTVLIAQRCNVTIRLGTYFLPKFP
FT                   TGDLSPEDFLIQKSKEGLEERLQTLFPDPQVRSEKRKEYDDRLQTELDVINKMGFPGYF
FT                   LIVMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSMP
FT                   DFDVDFCMDKRDRVIEHVAETYGRGAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRI
FT                   AKLIPADPGMTLTKAFEAEPRLSEIYNNDEEVKALIDMARKLEGVTRNAGKHAGGVVIS
FT                   PSLITDFSPLYCDSEGKHPVTHFDKNDVEYAGLVKFDFLGLRTLTIIKWALDMINARLV
FT                   KEGKSAVDISTIPLNDPDSFNLLKKAETTAVFQLESRGMKDLIKKLQPDCFEDIIALVA
FT                   LFRPGPLESGMVQNFIDRKHGVEPVSYPDVKYQHESLKPILEPTYGVIVYQEQVMQIAQ
FT                   VLAGYSLGGADLLRRAMGKKKPEEMAAQRDIFEKGAIAKGIDGDLAMKIFDLVEKFAGY
FT                   GFNKSHSAAYALVSYQTLWLKTHYPAEFMAAVMTSEMDNTDKIVSFYDECLRMGLTIVP
FT                   PDINTGKHHFSVNDNGEIVYGIGAIKGVGEVPINAIVSAREQGGIFKDLFDLCARVDLK
FT                   QINRRTFENLIKSGAFDKLGPHRAALAQNLEDALKASDQHAKDEAIGQVDMFGVLTSSH
FT                   EDVETAYAHTPRWSEKQILDGERETLGLYLSSHPITRYLKELSHYSSTRLNELSPNTRG
FT                   KISTVCGLIVALRFAVTKKGNRLGIATLDDRSGLLDITLFADALERFGDKLQKDTVVIV
FT                   SGTVSFDDFSQGLKMSVRELMTLDEARSRYAKNLAISLSQEQITPHFIRQLKGIIEPCS
FT                   GGSLPIHLYYQSKDGRALIRFGVQWSVYPTDELLSALVTMLGENAVELEFD"
     MSQPRFVHLR VHSDFSMING ITKVKPLIKA CVQHEMVAMA LTDFTNFCGL VRFYGEAQSS        60
     GVKPIIGADV LVKSDLLGDE LFELTLLAKN NEGYHNITLL LSKAYERGYY NLPYIDQSWL       120
     AEHHEGIIIL SGGRNGDVGK KLLKNNSADV ETAVAFYQEY FPDHFYLSLS RTGRSDEDRY       180
     IQSALILAQQ KQLPLVATND VCFLSPEDFE AHEIRVAIHD GYTLDDPKRP KLYSSQQYFR       240
     SEQEMCELFA DIPTALENTV LIAQRCNVTI RLGTYFLPKF PTGDLSPEDF LIQKSKEGLE       300
     ERLQTLFPDP QVRSEKRKEY DDRLQTELDV INKMGFPGYF LIVMEFIQWS KDNDIPVGPG       360
     RGSGAGSLVA YALKITDLDP LEFDLLFERF LNPERVSMPD FDVDFCMDKR DRVIEHVAET       420
     YGRGAVSQII TFGTMAAKAV IRDVGRVLGH PYGFVDRIAK LIPADPGMTL TKAFEAEPRL       480
     SEIYNNDEEV KALIDMARKL EGVTRNAGKH AGGVVISPSL ITDFSPLYCD SEGKHPVTHF       540
     DKNDVEYAGL VKFDFLGLRT LTIIKWALDM INARLVKEGK SAVDISTIPL NDPDSFNLLK       600
     KAETTAVFQL ESRGMKDLIK KLQPDCFEDI IALVALFRPG PLESGMVQNF IDRKHGVEPV       660
     SYPDVKYQHE SLKPILEPTY GVIVYQEQVM QIAQVLAGYS LGGADLLRRA MGKKKPEEMA       720
     AQRDIFEKGA IAKGIDGDLA MKIFDLVEKF AGYGFNKSHS AAYALVSYQT LWLKTHYPAE       780
     FMAAVMTSEM DNTDKIVSFY DECLRMGLTI VPPDINTGKH HFSVNDNGEI VYGIGAIKGV       840
     GEVPINAIVS AREQGGIFKD LFDLCARVDL KQINRRTFEN LIKSGAFDKL GPHRAALAQN       900
     LEDALKASDQ HAKDEAIGQV DMFGVLTSSH EDVETAYAHT PRWSEKQILD GERETLGLYL       960
     SSHPITRYLK ELSHYSSTRL NELSPNTRGK ISTVCGLIVA LRFAVTKKGN RLGIATLDDR      1020
     SGLLDITLFA DALERFGDKL QKDTVVIVSG TVSFDDFSQG LKMSVRELMT LDEARSRYAK      1080
     NLAISLSQEQ ITPHFIRQLK GIIEPCSGGS LPIHLYYQSK DGRALIRFGV QWSVYPTDEL      1140
     LSALVTMLGE NAVELEFD                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page