(data stored in ACNUC7421 zone)

EMBL: CP000947.PE67

CP000947.PE67        Location/Qualifiers
FT   CDS             complement(63366..65936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0067"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; Clp domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; ATPase AAA-2 domain protein; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0199 ATP-dependent Clp protease, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32329"
FT                   /db_xref="GOA:B0UV25"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV25"
FT                   /protein_id="ACA32329.1"
FT                   /translation="MNIDKLTTKFQQAIAEAQSLAIGKDHQFIEPVHLMTALLNQQDGS
FT                   IPPLLTASGGNLALLHNDLAAELSRLPQVSGNNGDIQVSRSLVKLLNLCDKLAQQRQDK
FT                   FISSELFLLAILEDKGALSESLKKCGIKQENLLQAIDKLRGGEKVNEQGAEENRQALEK
FT                   YTIDLTARAESGKLDPVIGRDEEIRRAIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVNGEVPEGLKGKRVLSLDMGALIAGAKYRGEFEERLKAVLKELAQEEGRVILFIDEIH
FT                   TMVGAGKTDGAMDAGNLLKPSLARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVGE
FT                   PTVEDTIAILRGLKERYEIHHHVQITDPAIVAAATLSHRYISDRQLPDKAIDLIDEAAS
FT                   SIRMEIDSKPQPLDRLERRIIQLKLEQQALQKEDDEASRKRLDLLEEELGEKEREYAEL
FT                   EDVWKAEKAALSGAQHIKAELDNAKIQMEQARRISDFAKMSELQYGRIPELEKQLAQAE
FT                   SAEGKEMTLLRNRVTDEEIAEVLSRATGIPVAKMMEGEKDKLLRMEQELHKRVVGQSEA
FT                   VVAVANAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKTLANFMFDDENAMVRIDMS
FT                   EFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHSDVFNILLQVL
FT                   DDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQGNKELDYNAMKEVVMSVVGQHFRPEFI
FT                   NRIDETVVFHPLAKENIRAIATIQLQRLVKRMETHGYQLEFTDATLDFIGEVGYDVIYG
FT                   ARPLKRAIQQEIENPLAQQILSGQLLPGKKVIVDYVDGKVVAKQ"
     MNIDKLTTKF QQAIAEAQSL AIGKDHQFIE PVHLMTALLN QQDGSIPPLL TASGGNLALL        60
     HNDLAAELSR LPQVSGNNGD IQVSRSLVKL LNLCDKLAQQ RQDKFISSEL FLLAILEDKG       120
     ALSESLKKCG IKQENLLQAI DKLRGGEKVN EQGAEENRQA LEKYTIDLTA RAESGKLDPV       180
     IGRDEEIRRA IQVLQRRTKN NPVLIGEPGV GKTAIVEGLA QRIVNGEVPE GLKGKRVLSL       240
     DMGALIAGAK YRGEFEERLK AVLKELAQEE GRVILFIDEI HTMVGAGKTD GAMDAGNLLK       300
     PSLARGELHC VGATTLDEYR QYIEKDAALE RRFQKVFVGE PTVEDTIAIL RGLKERYEIH       360
     HHVQITDPAI VAAATLSHRY ISDRQLPDKA IDLIDEAASS IRMEIDSKPQ PLDRLERRII       420
     QLKLEQQALQ KEDDEASRKR LDLLEEELGE KEREYAELED VWKAEKAALS GAQHIKAELD       480
     NAKIQMEQAR RISDFAKMSE LQYGRIPELE KQLAQAESAE GKEMTLLRNR VTDEEIAEVL       540
     SRATGIPVAK MMEGEKDKLL RMEQELHKRV VGQSEAVVAV ANAIRRSRAG LSDPNRPIGS       600
     FLFLGPTGVG KTELCKTLAN FMFDDENAMV RIDMSEFMEK HSVSRLVGAP PGYVGYEEGG       660
     YLTEAVRRRP YSVILLDEVE KAHSDVFNIL LQVLDDGRLT DGQGRTVDFR NTVVIMTSNL       720
     GSDLIQGNKE LDYNAMKEVV MSVVGQHFRP EFINRIDETV VFHPLAKENI RAIATIQLQR       780
     LVKRMETHGY QLEFTDATLD FIGEVGYDVI YGARPLKRAI QQEIENPLAQ QILSGQLLPG       840
     KKVIVDYVDG KVVAKQ                                                       856
//

If you have problems or comments...

PBIL Back to PBIL home page