(data stored in ACNUC7421 zone)

EMBL: CP000947.PE68

CP000947.PE68        Location/Qualifiers
FT   CDS             complement(66120..66581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0068"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   hso:HS_0200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32340"
FT                   /db_xref="GOA:B0UV26"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV26"
FT                   /protein_id="ACA32340.1"
FT                   /translation="MLLPFILIALCAGIALAAQAAINTQLAQSLSGQPVFAAFVSFAMG
FT                   TIALFFICWWKMDLFSALQQVPKQPLWKLIGGLLGALAVFTTIFLAPKIGVTNMLFFII
FT                   VGQLLTALIIDHFGLIGMTQRAVNVWQLIGFVVIGFGLLLFFFGKKLFH"
     MLLPFILIAL CAGIALAAQA AINTQLAQSL SGQPVFAAFV SFAMGTIALF FICWWKMDLF        60
     SALQQVPKQP LWKLIGGLLG ALAVFTTIFL APKIGVTNML FFIIVGQLLT ALIIDHFGLI       120
     GMTQRAVNVW QLIGFVVIGF GLLLFFFGKK LFH                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page