(data stored in ACNUC7421 zone)

EMBL: CP000947.PE69

CP000947.PE69        Location/Qualifiers
FT   CDS             66765..67022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0069"
FT                   /product="sodium pump decarboxylase, gamma subunit"
FT                   /note="TIGRFAM: sodium pump decarboxylase, gamma subunit;
FT                   PFAM: sodium pump decarboxylase gamma subunit; KEGG:
FT                   hso:HS_0201 oxaloacetate decarboxylase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32351"
FT                   /db_xref="GOA:B0UV27"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV27"
FT                   /protein_id="ACA32351.1"
FT                   /translation="MTNTNVQLIQEGVNLMLSGMGFVLVFLLILIFAIKLMSKLIGYFS
FT                   SEPTLPQQAFIPTTELNDLERLRPVIVAAIAHHRRQQNLQ"
     MTNTNVQLIQ EGVNLMLSGM GFVLVFLLIL IFAIKLMSKL IGYFSSEPTL PQQAFIPTTE        60
     LNDLERLRPV IVAAIAHHRR QQNLQ                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page