(data stored in ACNUC7421 zone)

EMBL: CP000947.PE71

CP000947.PE71        Location/Qualifiers
FT   CDS             68847..70151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0071"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.70"
FT                   /note="TIGRFAM: sodium ion-translocating decarboxylase,
FT                   beta subunit; PFAM: Na+transporting
FT                   methylmalonyl-CoA/oxaloacetate decarboxylase beta subunit;
FT                   KEGG: hso:HS_0203 oxaloacetate decarboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32374"
FT                   /db_xref="GOA:B0UV29"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV29"
FT                   /protein_id="ACA32374.1"
FT                   /translation="MESILALLQGTGIMHLSWGQAIMLVISLLLLYLAVVKKFEPLLLL
FT                   PIGFGGLLSNIPEANMAFSALENLLHSNNNQHLSTLANLLHSDTDVQAIKQVLEKAPAL
FT                   LHVQAELLAKDLGYTDGVLSTFYDVAINSGAAPLIIFMGVGAMTDFGPLLANPKTLLLG
FT                   AAAQFGIFATVLGALALNGLGIIEFTLPQAAAIGIIGGADGPTAIYLASKLAPELLGAI
FT                   AVAAYSYMALVPLIQPPIMRLLTTKQERKIKMVQLRNVSNREKILFPIVLLVLVALLLP
FT                   DAAPLLGMFCFGNLMRVSGVVERLSDTAQNALINIVTIFLGLSVGAKLVADKFLQPQTL
FT                   GILLLGIIAFAIGTASGVLMAKLMNCFSKDKINPLIGSAGVSAVPMAARVSNKLGLEAD
FT                   HQNFLLMHAMGPNVAGVIGSAIAAGVMLKYIAAMM"
     MESILALLQG TGIMHLSWGQ AIMLVISLLL LYLAVVKKFE PLLLLPIGFG GLLSNIPEAN        60
     MAFSALENLL HSNNNQHLST LANLLHSDTD VQAIKQVLEK APALLHVQAE LLAKDLGYTD       120
     GVLSTFYDVA INSGAAPLII FMGVGAMTDF GPLLANPKTL LLGAAAQFGI FATVLGALAL       180
     NGLGIIEFTL PQAAAIGIIG GADGPTAIYL ASKLAPELLG AIAVAAYSYM ALVPLIQPPI       240
     MRLLTTKQER KIKMVQLRNV SNREKILFPI VLLVLVALLL PDAAPLLGMF CFGNLMRVSG       300
     VVERLSDTAQ NALINIVTIF LGLSVGAKLV ADKFLQPQTL GILLLGIIAF AIGTASGVLM       360
     AKLMNCFSKD KINPLIGSAG VSAVPMAARV SNKLGLEADH QNFLLMHAMG PNVAGVIGSA       420
     IAAGVMLKYI AAMM                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page