(data stored in ACNUC7421 zone)

EMBL: CP000947.PE73

CP000947.PE73        Location/Qualifiers
FT   CDS             71365..73710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0073"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: OstA family protein; Organic solvent tolerance
FT                   protein; KEGG: hso:HS_0205 organic solvent tolerance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32396"
FT                   /db_xref="GOA:B0UV31"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV31"
FT                   /protein_id="ACA32396.1"
FT                   /translation="MKKNYYTVLSLSILTALYSTSSQANLQQQCLIGVPHFQGEIVQGD
FT                   PNELPVYIEADHAKMNQSTHAQYEGNVNVKQGNRHLTAGMIEIEQHGKDNAKRYAYAKN
FT                   GFDYKDNLIQLNGDNAKIHLDSKDANIQDADYQLVGRQGRGTADEVELREHYRVMKNAT
FT                   FTSCLPNSDAWSIEAKEMRQHIQEEYAEMWHARFKVSGIPIFYTPYLQLPIGDRRRSGL
FT                   LIPKAGISTRHGYWYAQPFYWNIAPNFDATFTPKYMSHRGWQLNAETRYLTRIGEGKFV
FT                   VEYLKTDRHSDYLNTARSRHLFYWGHNSHFLKDWRLNVNYTKVSDKHYFNDFESEYGNS
FT                   TDGYVDQQASISYYQPNYNLSISAKQFQIFDKVDIGPYRALPQIDFNYYRNEIANGLVD
FT                   FSLFSQVVRFDNDSALMPTAWRFHIEPSLTFPLSNRYGSLNIETKLYATRYLQKRGKGE
FT                   NAEEIKKTVNRVLPQIKLDFQTVLANRQSFIEGYTQTLEPRFQYLYRPYKDQSDIGLKQ
FT                   QNNDYLGFGYDSTLLQQDYFSLFRDRRYSGLDRIVSANQITLGGTTRFYDKNANERFNL
FT                   SIGQIYYLKDSRTDNNPQNMAQGRSSSWSLESNWRINSKWNWRGSYQYDTHLNQTSLAN
FT                   TVLEYNSEKNNLIQLSYRYVNQSYIDQNLIGKNTYGQSIKQLGMTTAWELTDHWTLVGR
FT                   YYQDLALKKPVEQYLGIQYNSCCWSIGVGARRYVTNRANQRNDEVLYDNSLSLTFELRG
FT                   LSPSDHKNNIDEMLKKGKLPYIKAFSLY"
     MKKNYYTVLS LSILTALYST SSQANLQQQC LIGVPHFQGE IVQGDPNELP VYIEADHAKM        60
     NQSTHAQYEG NVNVKQGNRH LTAGMIEIEQ HGKDNAKRYA YAKNGFDYKD NLIQLNGDNA       120
     KIHLDSKDAN IQDADYQLVG RQGRGTADEV ELREHYRVMK NATFTSCLPN SDAWSIEAKE       180
     MRQHIQEEYA EMWHARFKVS GIPIFYTPYL QLPIGDRRRS GLLIPKAGIS TRHGYWYAQP       240
     FYWNIAPNFD ATFTPKYMSH RGWQLNAETR YLTRIGEGKF VVEYLKTDRH SDYLNTARSR       300
     HLFYWGHNSH FLKDWRLNVN YTKVSDKHYF NDFESEYGNS TDGYVDQQAS ISYYQPNYNL       360
     SISAKQFQIF DKVDIGPYRA LPQIDFNYYR NEIANGLVDF SLFSQVVRFD NDSALMPTAW       420
     RFHIEPSLTF PLSNRYGSLN IETKLYATRY LQKRGKGENA EEIKKTVNRV LPQIKLDFQT       480
     VLANRQSFIE GYTQTLEPRF QYLYRPYKDQ SDIGLKQQNN DYLGFGYDST LLQQDYFSLF       540
     RDRRYSGLDR IVSANQITLG GTTRFYDKNA NERFNLSIGQ IYYLKDSRTD NNPQNMAQGR       600
     SSSWSLESNW RINSKWNWRG SYQYDTHLNQ TSLANTVLEY NSEKNNLIQL SYRYVNQSYI       660
     DQNLIGKNTY GQSIKQLGMT TAWELTDHWT LVGRYYQDLA LKKPVEQYLG IQYNSCCWSI       720
     GVGARRYVTN RANQRNDEVL YDNSLSLTFE LRGLSPSDHK NNIDEMLKKG KLPYIKAFSL       780
     Y                                                                       781
//

If you have problems or comments...

PBIL Back to PBIL home page