(data stored in ACNUC7421 zone)

EMBL: CP000947.PE75

CP000947.PE75        Location/Qualifiers
FT   CDS             complement(74958..76127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0075"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: hso:HS_0207
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32418"
FT                   /db_xref="GOA:B0UV33"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV33"
FT                   /protein_id="ACA32418.1"
FT                   /translation="MSVIKMTDLDLAGKRVFIRADLNVPVKEGKVTSDARIKATIPTLK
FT                   LALEKGAKVMVTSHLGRPTEGEFKPEDSLQPVVDYLKGAGFNVRLAQDYLNGVEVNEGE
FT                   IVVLENVRVNKGEKKNDPELSKKYAALCDVFVMDAFGTAHRAQASTYGVAEFAPVACAG
FT                   PLLAAELEALGKALKEPQRPMLAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFIA
FT                   AEGHNVGKSLYEADLIPEAQRLSKVTNIPVPVDVRVGTEFSETALSTEKSVADVSGEES
FT                   IFDIGDKSAEQLADIIRNAKTILWNGPVGVFEFPNFRKGTEIVSNAIAEATANGAFSIA
FT                   GGGDTLAAIDLFGIKDKISYISTGGGAFLEFVEGKVLPAVEILEKRANG"
     MSVIKMTDLD LAGKRVFIRA DLNVPVKEGK VTSDARIKAT IPTLKLALEK GAKVMVTSHL        60
     GRPTEGEFKP EDSLQPVVDY LKGAGFNVRL AQDYLNGVEV NEGEIVVLEN VRVNKGEKKN       120
     DPELSKKYAA LCDVFVMDAF GTAHRAQAST YGVAEFAPVA CAGPLLAAEL EALGKALKEP       180
     QRPMLAIVGG SKVSTKLTVL DSLSKIADQL IVGGGIANTF IAAEGHNVGK SLYEADLIPE       240
     AQRLSKVTNI PVPVDVRVGT EFSETALSTE KSVADVSGEE SIFDIGDKSA EQLADIIRNA       300
     KTILWNGPVG VFEFPNFRKG TEIVSNAIAE ATANGAFSIA GGGDTLAAID LFGIKDKISY       360
     ISTGGGAFLE FVEGKVLPAV EILEKRANG                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page