(data stored in ACNUC7421 zone)

EMBL: CP000947.PE76

CP000947.PE76        Location/Qualifiers
FT   CDS             76366..76626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0076"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: hso:HS_0208 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32429"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV34"
FT                   /protein_id="ACA32429.1"
FT                   /translation="MALLITDKCTNCDMCLPECPNDAISIGDEIYIIDPHLCTECVGHY
FT                   DTPTCQNVCPITNCIKIDPEHIETEEQLWERFVLIHHADKI"
     MALLITDKCT NCDMCLPECP NDAISIGDEI YIIDPHLCTE CVGHYDTPTC QNVCPITNCI        60
     KIDPEHIETE EQLWERFVLI HHADKI                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page