(data stored in ACNUC7421 zone)

EMBL: CP000947.PE77

CP000947.PE77        Location/Qualifiers
FT   CDS             complement(76675..88866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0077"
FT                   /product="YadA domain protein"
FT                   /note="PFAM: YadA domain protein; Haemagluttinin domain
FT                   protein; Hep_Hag repeat-containing protein; KEGG:
FT                   hso:HS_0790 possible large adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32440"
FT                   /db_xref="GOA:B0UV35"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV35"
FT                   /protein_id="ACA32440.1"
FT                   /translation="MNKIFKTKYDVTTGQCKAVSELASNRQIASSSKSKPKCGVFLGNF
FT                   LGIFKFSPLVLLMSGMLGVSSVSYADITYIDMDGNTGAAGVRENWREADYWKKNGRENT
FT                   LLTQVQNSPRKYDKDVNTNVYKSVIIGPHSAGVNTNRDQSTGVGMTILGHGAVGFASQT
FT                   TAIGNNVYSGGQQATALGSDVMAAGYASIAIGNDDIANTYRDKLPEKTIMKIYGYDTNT
FT                   RYSGTTYKNILNEQNFKMKYGINNGVDNRIYSPTYAAGVASIAIGSRSVAYGNASLAIG
FT                   TLSFALANDSTAVGVRAFVNDDATGGVAIGDESRVFAANSFAIGNETEATNQGALTFGS
FT                   GSKAVGIGSIAIGSNVASNALIASNGYETFQNSIMQHTQNSSPVVEVDRHNEYNTLFKI
FT                   DENNLKYGDENHIVKLGFNASNPSNSKNPISEIIEKVISDKKRIAFSHERDEVIETTSK
FT                   IYKTTKEGDHSISLGYHLSNNGDNTITIGSASVVRGANSVVLGALNNIGKYARNTIALG
FT                   IGTNVYKENSVAIGTGINVIGAGAVAIGSGVGVTKDNTISIGYGSHGLSSESIVLGNSA
FT                   SLKDHSKKSILIGNSAKVENQSQNKNVKIANLKKGKFGLEAEKVELEMSAISIGTESYV
FT                   YSEKGIALGDNAKIEANSENAIAFGTNSKASKKSAIALGNETEATMENSVALGYKSHTK
FT                   YFYQDANKNTATLTGKEAIDLTPYVPEGSSYSLRTDKSAGIISVGWTKGNSGSQELGLR
FT                   RIVGVAPGALDSDVATIGQLKALEYVKREGLVVYYTEDNGKIYKLVKGTDGKFYKVNTK
FT                   NGTPLDKQEIPKEKVLVGAKGHNEKIQYINADKQIADIGEKIRFGHLADGEISQTSDQA
FT                   ITGNQLKNVGDILGVSVNTPNNTQFDRYKFTAVDYKGSQKKQKTIFKDAIEELITAVNK
FT                   GIVIQDADSHTGTLNLGSTLTIKAGNIDKPKSDVDGFSSDNIKTSYQPTRKELLIGIKD
FT                   KPIFKEVTISGTVNDRSDKKTLTTKEYVDGKLANVATSFTVNGNMGNYIVQSALNIKGK
FT                   ADASQHKNITTEAKTNEKELEISLNKDLKDIASITGEGIKSGKNTVYSKIAFNSTNGSN
FT                   ATTNVTISSNGANYTFDRTGFDMSDRRITRLQSGLNTQHHGPKGANGNPENVSKILDGS
FT                   YITTIKGNAVNVSDLSNVAKAIVEKGLKFAGDSGSEITRKLGEKLTIKGNGTDLTSKTD
FT                   SNKGEITFTLHKATSIDDNTATNSNKDKVVTAGAVKTYLDSKIDEVSTTLGLEADNSKN
FT                   SGPTGKVNLKNEKLKVAGTSDEIETKVEQDKQSITLSFAQNTKNKLGMITVDGDKLALG
FT                   KNAKTVDKMTAPKEAKVTVGNDSLKFNWTGGVSADDKEQSKKSVISVGDTGKEHLITHV
FT                   AAGKVEVNSTDAINGSQLYGVVDAFSKLAINVLGAKADLTSGFKKSSFDVVKYNGNTNT
FT                   QTSKEMTFKDAIGQNTTAINKGFIFGVGDSNNEQGTHYLGDKLIIKAGAVDKPTSTSDD
FT                   GYSPDNIKTAYLAKSKELLIGIKDKPTFKEVKVSGTVDDSSDGKTLTTKTYVDGKLANV
FT                   AANFDVKGDNNVVYTLNKQNNVLNINGDTKNITTAVDKNAKKVSITLKEALTGITSIGK
FT                   DTNNQIAFSDSGTILKAGGSSLNLTGSSGKVKISNVANGTSDNDAINKSQLNSVVSALG
FT                   GEAKIGADGNVIAPSYTLANGNKAPYTTVGEALSALDEVLTSVNGAGITFSDGTTNNDF
FT                   VRKNSENDKKVVIKSGSNINVSLSKTNSDKTGEFTVALNKDLEDINSITLKDSGGHSAT
FT                   NKTGKITIDGVTGDVKVQHGDGRASKIVIESGLNALTGNDEIQVTGGGKVFGNASLSLK
FT                   DASIAGTKLKDNTIAEAKLDQGIKDKLNKTFMVKAEGATSDNLIGNTLEFAAKDSNLTV
FT                   ELDKSNKKISYGLSSTLTGIESIAKDKTKISLADTKIKLMPEEGAALTLTKSDTDKVKI
FT                   SGLGDGQIDGASNEAITGKQLHDLAGKLGVTVDNAKAGFTQPSFTKVNYQGQTETNGKT
FT                   TFKEAINDLIVAVNKGLVVGDGTVKGTLQLGDTLQIKAGNIDKKSTSDDGFSSDNIKTS
FT                   YQQNTKELLIGIKDKPSFKQVTVTEEINEKSPKTALTTKKYVDSKATQNEQAIANQEIK
FT                   YKANGAGDNKVKLSEGLDFKNDDNITVTADAGGAITHKLNADLKNITSIAGKGDSGTAP
FT                   KIDFANGDGLKISSKGTDLTLKADGLDLNNKQITGIASGLDQKMNGASGRQDLDELLKL
FT                   VATGQPQNGGTSNDGKLNKAINAGDLLHIANELKNKGLSFQGNDGKDVTRKLGETLKIV
FT                   GETSATTPTDSTQPAMETAPDNITVAKKTGNGDDTLEIKLSKNLKGIASIANGDKAKIA
FT                   LDKDKGTITFTAGDQARSKDVTLSAGKFSGVSEINKEEGKGALKLTENTATLESAKDNS
FT                   KLELKDKAVTLESTKDGSSVTLDGTSATLSAGKNKGSIKVTNGADNKIELSPENGSTVM
FT                   LKKDMTNGGVQATGLSTIGKDDDNALVFKNSTSGTDKTAELKVGGSALTFTKATTGNTV
FT                   KISNVEDGKIDTSSTEAITGKQLHDLASKLGVEVESETGFKQPSFTAIKGGTSSTGGTT
FT                   NSNTGPTTFKEAINQLITAVNGGLTFKGNDNGSSPSSTTLQLGGTLTIDSSTSKVKADG
FT                   MAEATQKDITVSLAPSNGNNPQSAGTLTLKLNKATTVSETDEKVVTSKAVATKLKEYTT
FT                   TAQLQTDFLKVDGSNIGDKKLALGKNVGIDTIKLGETEKSTTELVQADAVIKYLKGTGD
FT                   KSVKVSDNPETKADGEGSIAIGDKAVAENEGAIAIGYDTSAKNRRSVAIGREAQVLGEH
FT                   ATAIGYKNNVSGNDSGAFGKDNEIIGKHSYAVGAYNKIEGDHVYALGSNITTTKDITNA
FT                   VILGNKSTGVSNAVSVGGAGKDEQRRIVYVATPTDKYDAVNKKYVDDLTLSYKTNSDDK
FT                   TKQSINLKTGALDFKKSENISVSVEADGKITHTLNNNLQEITSIKGGKDESGAKITLET
FT                   AKKEISFNDSKLTNLADGEIGDSSKEAVTGKQLADLAKQLGIAVDTSDKTKFTAPTFDN
FT                   FKLKDINGTDGTAPKNIVEGLKNAVSKLNEGLKFSADMPSAVANGTQSTPHYLGSTLSI
FT                   VRLDMNQAGSSATPAPAGTSSQPNIAEFKGDNLITQYTREANGNAKIEIGFKNAPTFSK
FT                   VMLAEEQTYNGVNGNSGSTDWKKELITKGYLEQALDKFKFKVENGSGKTIEIGRNDTLK
FT                   FTSGQNIKVDLAKNGTTPSSTGSTSPSASAPAPTPAAPASVSSAAPSSSSGGAGSNGGG
FT                   SNSMASSGGSNGAGMATTTPTSAPTTTPTTTTPTTTAVVTIGTTEELKNITSISSKPKA
FT                   GSAGGSGTGSSAVGNQDEVTKLTLDAEKGATFQVGNQGTEVNINKDGISLTPQSKDGKA
FT                   TLNKDGLTVGDKEAANGDKTHTVYGKDGLTVKGKDSSKEVVSLKVADGENSQGNNGGNG
FT                   QSATLAFAKIGNGSGAGTGADAKGTGTGKITGLADIKPDEKDGTLATNKNYVDGKVSDL
FT                   NNNRPFDFYLNGEKVVKDKDGNFKKLKDGKPDQLLTEEEKKQVVIKAEPSTAPIGISNV
FT                   ASGLGITTPTKDEKKQLSELAEKVNEKVEALGEKAKTLSDTATKLADLELMVDSLKQTI
FT                   DTLPDGEAKEKIRENLKKYETQLSDAQEAKKNAEEAVESARNELIEANGDYNAFSEAMA
FT                   KVEELVEPDSQANLSNVATVGDLQAVARAGLNFVGNDDVTVHKNVGETLSITGEGTFNS
FT                   NRTATGNIKVEMAQDGKGLEVKLSDQLKNMTSFETREVEGRKSTLDSNGLRVVNKGKDG
FT                   TDDKAKSATYGAEAVVLEDKNKSDKAVITAGGIRFADSSTQTTALSTELNKNGLTVNGA
FT                   GGQIHIDGTKGVITVPNIKPNADGHVVVNKNYVDTKNNELRTQMNNNDRNMRAGVAQAV
FT                   AQANLPINILPGKSTLSLATGNYMGSQAFAVGYSRVSDNGKLSVKFSLGHGDKKTSVGA
FT                   GVGYSW"
     MNKIFKTKYD VTTGQCKAVS ELASNRQIAS SSKSKPKCGV FLGNFLGIFK FSPLVLLMSG        60
     MLGVSSVSYA DITYIDMDGN TGAAGVRENW READYWKKNG RENTLLTQVQ NSPRKYDKDV       120
     NTNVYKSVII GPHSAGVNTN RDQSTGVGMT ILGHGAVGFA SQTTAIGNNV YSGGQQATAL       180
     GSDVMAAGYA SIAIGNDDIA NTYRDKLPEK TIMKIYGYDT NTRYSGTTYK NILNEQNFKM       240
     KYGINNGVDN RIYSPTYAAG VASIAIGSRS VAYGNASLAI GTLSFALAND STAVGVRAFV       300
     NDDATGGVAI GDESRVFAAN SFAIGNETEA TNQGALTFGS GSKAVGIGSI AIGSNVASNA       360
     LIASNGYETF QNSIMQHTQN SSPVVEVDRH NEYNTLFKID ENNLKYGDEN HIVKLGFNAS       420
     NPSNSKNPIS EIIEKVISDK KRIAFSHERD EVIETTSKIY KTTKEGDHSI SLGYHLSNNG       480
     DNTITIGSAS VVRGANSVVL GALNNIGKYA RNTIALGIGT NVYKENSVAI GTGINVIGAG       540
     AVAIGSGVGV TKDNTISIGY GSHGLSSESI VLGNSASLKD HSKKSILIGN SAKVENQSQN       600
     KNVKIANLKK GKFGLEAEKV ELEMSAISIG TESYVYSEKG IALGDNAKIE ANSENAIAFG       660
     TNSKASKKSA IALGNETEAT MENSVALGYK SHTKYFYQDA NKNTATLTGK EAIDLTPYVP       720
     EGSSYSLRTD KSAGIISVGW TKGNSGSQEL GLRRIVGVAP GALDSDVATI GQLKALEYVK       780
     REGLVVYYTE DNGKIYKLVK GTDGKFYKVN TKNGTPLDKQ EIPKEKVLVG AKGHNEKIQY       840
     INADKQIADI GEKIRFGHLA DGEISQTSDQ AITGNQLKNV GDILGVSVNT PNNTQFDRYK       900
     FTAVDYKGSQ KKQKTIFKDA IEELITAVNK GIVIQDADSH TGTLNLGSTL TIKAGNIDKP       960
     KSDVDGFSSD NIKTSYQPTR KELLIGIKDK PIFKEVTISG TVNDRSDKKT LTTKEYVDGK      1020
     LANVATSFTV NGNMGNYIVQ SALNIKGKAD ASQHKNITTE AKTNEKELEI SLNKDLKDIA      1080
     SITGEGIKSG KNTVYSKIAF NSTNGSNATT NVTISSNGAN YTFDRTGFDM SDRRITRLQS      1140
     GLNTQHHGPK GANGNPENVS KILDGSYITT IKGNAVNVSD LSNVAKAIVE KGLKFAGDSG      1200
     SEITRKLGEK LTIKGNGTDL TSKTDSNKGE ITFTLHKATS IDDNTATNSN KDKVVTAGAV      1260
     KTYLDSKIDE VSTTLGLEAD NSKNSGPTGK VNLKNEKLKV AGTSDEIETK VEQDKQSITL      1320
     SFAQNTKNKL GMITVDGDKL ALGKNAKTVD KMTAPKEAKV TVGNDSLKFN WTGGVSADDK      1380
     EQSKKSVISV GDTGKEHLIT HVAAGKVEVN STDAINGSQL YGVVDAFSKL AINVLGAKAD      1440
     LTSGFKKSSF DVVKYNGNTN TQTSKEMTFK DAIGQNTTAI NKGFIFGVGD SNNEQGTHYL      1500
     GDKLIIKAGA VDKPTSTSDD GYSPDNIKTA YLAKSKELLI GIKDKPTFKE VKVSGTVDDS      1560
     SDGKTLTTKT YVDGKLANVA ANFDVKGDNN VVYTLNKQNN VLNINGDTKN ITTAVDKNAK      1620
     KVSITLKEAL TGITSIGKDT NNQIAFSDSG TILKAGGSSL NLTGSSGKVK ISNVANGTSD      1680
     NDAINKSQLN SVVSALGGEA KIGADGNVIA PSYTLANGNK APYTTVGEAL SALDEVLTSV      1740
     NGAGITFSDG TTNNDFVRKN SENDKKVVIK SGSNINVSLS KTNSDKTGEF TVALNKDLED      1800
     INSITLKDSG GHSATNKTGK ITIDGVTGDV KVQHGDGRAS KIVIESGLNA LTGNDEIQVT      1860
     GGGKVFGNAS LSLKDASIAG TKLKDNTIAE AKLDQGIKDK LNKTFMVKAE GATSDNLIGN      1920
     TLEFAAKDSN LTVELDKSNK KISYGLSSTL TGIESIAKDK TKISLADTKI KLMPEEGAAL      1980
     TLTKSDTDKV KISGLGDGQI DGASNEAITG KQLHDLAGKL GVTVDNAKAG FTQPSFTKVN      2040
     YQGQTETNGK TTFKEAINDL IVAVNKGLVV GDGTVKGTLQ LGDTLQIKAG NIDKKSTSDD      2100
     GFSSDNIKTS YQQNTKELLI GIKDKPSFKQ VTVTEEINEK SPKTALTTKK YVDSKATQNE      2160
     QAIANQEIKY KANGAGDNKV KLSEGLDFKN DDNITVTADA GGAITHKLNA DLKNITSIAG      2220
     KGDSGTAPKI DFANGDGLKI SSKGTDLTLK ADGLDLNNKQ ITGIASGLDQ KMNGASGRQD      2280
     LDELLKLVAT GQPQNGGTSN DGKLNKAINA GDLLHIANEL KNKGLSFQGN DGKDVTRKLG      2340
     ETLKIVGETS ATTPTDSTQP AMETAPDNIT VAKKTGNGDD TLEIKLSKNL KGIASIANGD      2400
     KAKIALDKDK GTITFTAGDQ ARSKDVTLSA GKFSGVSEIN KEEGKGALKL TENTATLESA      2460
     KDNSKLELKD KAVTLESTKD GSSVTLDGTS ATLSAGKNKG SIKVTNGADN KIELSPENGS      2520
     TVMLKKDMTN GGVQATGLST IGKDDDNALV FKNSTSGTDK TAELKVGGSA LTFTKATTGN      2580
     TVKISNVEDG KIDTSSTEAI TGKQLHDLAS KLGVEVESET GFKQPSFTAI KGGTSSTGGT      2640
     TNSNTGPTTF KEAINQLITA VNGGLTFKGN DNGSSPSSTT LQLGGTLTID SSTSKVKADG      2700
     MAEATQKDIT VSLAPSNGNN PQSAGTLTLK LNKATTVSET DEKVVTSKAV ATKLKEYTTT      2760
     AQLQTDFLKV DGSNIGDKKL ALGKNVGIDT IKLGETEKST TELVQADAVI KYLKGTGDKS      2820
     VKVSDNPETK ADGEGSIAIG DKAVAENEGA IAIGYDTSAK NRRSVAIGRE AQVLGEHATA      2880
     IGYKNNVSGN DSGAFGKDNE IIGKHSYAVG AYNKIEGDHV YALGSNITTT KDITNAVILG      2940
     NKSTGVSNAV SVGGAGKDEQ RRIVYVATPT DKYDAVNKKY VDDLTLSYKT NSDDKTKQSI      3000
     NLKTGALDFK KSENISVSVE ADGKITHTLN NNLQEITSIK GGKDESGAKI TLETAKKEIS      3060
     FNDSKLTNLA DGEIGDSSKE AVTGKQLADL AKQLGIAVDT SDKTKFTAPT FDNFKLKDIN      3120
     GTDGTAPKNI VEGLKNAVSK LNEGLKFSAD MPSAVANGTQ STPHYLGSTL SIVRLDMNQA      3180
     GSSATPAPAG TSSQPNIAEF KGDNLITQYT REANGNAKIE IGFKNAPTFS KVMLAEEQTY      3240
     NGVNGNSGST DWKKELITKG YLEQALDKFK FKVENGSGKT IEIGRNDTLK FTSGQNIKVD      3300
     LAKNGTTPSS TGSTSPSASA PAPTPAAPAS VSSAAPSSSS GGAGSNGGGS NSMASSGGSN      3360
     GAGMATTTPT SAPTTTPTTT TPTTTAVVTI GTTEELKNIT SISSKPKAGS AGGSGTGSSA      3420
     VGNQDEVTKL TLDAEKGATF QVGNQGTEVN INKDGISLTP QSKDGKATLN KDGLTVGDKE      3480
     AANGDKTHTV YGKDGLTVKG KDSSKEVVSL KVADGENSQG NNGGNGQSAT LAFAKIGNGS      3540
     GAGTGADAKG TGTGKITGLA DIKPDEKDGT LATNKNYVDG KVSDLNNNRP FDFYLNGEKV      3600
     VKDKDGNFKK LKDGKPDQLL TEEEKKQVVI KAEPSTAPIG ISNVASGLGI TTPTKDEKKQ      3660
     LSELAEKVNE KVEALGEKAK TLSDTATKLA DLELMVDSLK QTIDTLPDGE AKEKIRENLK      3720
     KYETQLSDAQ EAKKNAEEAV ESARNELIEA NGDYNAFSEA MAKVEELVEP DSQANLSNVA      3780
     TVGDLQAVAR AGLNFVGNDD VTVHKNVGET LSITGEGTFN SNRTATGNIK VEMAQDGKGL      3840
     EVKLSDQLKN MTSFETREVE GRKSTLDSNG LRVVNKGKDG TDDKAKSATY GAEAVVLEDK      3900
     NKSDKAVITA GGIRFADSST QTTALSTELN KNGLTVNGAG GQIHIDGTKG VITVPNIKPN      3960
     ADGHVVVNKN YVDTKNNELR TQMNNNDRNM RAGVAQAVAQ ANLPINILPG KSTLSLATGN      4020
     YMGSQAFAVG YSRVSDNGKL SVKFSLGHGD KKTSVGAGVG YSW                        4063
//

If you have problems or comments...

PBIL Back to PBIL home page