(data stored in ACNUC7421 zone)

EMBL: CP000947.PE79

CP000947.PE79        Location/Qualifiers
FT   CDS             complement(89441..90190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0079"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hso:HS_0210 polar amino acid ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32462"
FT                   /db_xref="GOA:B0UV37"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV37"
FT                   /protein_id="ACA32462.1"
FT                   /translation="MIKIRNIHKTFDNNPVLRGIDLDIEKGQVVVILGPSGSGKTTFLR
FT                   CLNALELPEQGTIEFHKENPLYIDFTDKHIRKNILPLRKKSGMVFQQYNLFPHKTALEN
FT                   IMEGPVQVQQRKPDEVRQEAETLLCKVGLIDKANLYPHQLSGGQQQRVGIARALAIRPE
FT                   LMLFDEPTSALDPELVQDVLNTMKGLANEGWTMVVVTHEIKFALDVADVVVVMDKGIIV
FT                   EQGSPKTLFENPQHERTKAFLHQIRFN"
     MIKIRNIHKT FDNNPVLRGI DLDIEKGQVV VILGPSGSGK TTFLRCLNAL ELPEQGTIEF        60
     HKENPLYIDF TDKHIRKNIL PLRKKSGMVF QQYNLFPHKT ALENIMEGPV QVQQRKPDEV       120
     RQEAETLLCK VGLIDKANLY PHQLSGGQQQ RVGIARALAI RPELMLFDEP TSALDPELVQ       180
     DVLNTMKGLA NEGWTMVVVT HEIKFALDVA DVVVVMDKGI IVEQGSPKTL FENPQHERTK       240
     AFLHQIRFN                                                               249
//

If you have problems or comments...

PBIL Back to PBIL home page