(data stored in ACNUC7421 zone)

EMBL: CP000947.PE8

CP000947.PE8         Location/Qualifiers
FT   CDS             complement(5922..7148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0008"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein; KEGG: hso:HS_0143 coenzyme A biosynthesis
FT                   phosphopantothenoylcysteine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32471"
FT                   /db_xref="GOA:B0UUW6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B0UUW6"
FT                   /protein_id="ACA32471.1"
FT                   /translation="MQNLIRGKRIVIGITGGIAAYKTIELIRLLRKAQAEVRVVLTNAA
FT                   TEFVTPLTLQAISGNAVSQSLLDHEAELAMGHIELAKWADLIVIAPASADFIARMAVGM
FT                   ANDLLSTICLATNSPIFLAPAMNQQMYAQTVTQQNLAQLMARGVQFIGPNSGEQACGDV
FT                   GIGKMSEPFEIFTALCQSFLHTQDLLDVSVVITAGPTREAIDPVRYISNHSSGKMGFAI
FT                   AEAFAQRGAKVTLISGPVNLATPHNVQRINVVSAQEMYQHAIQSAEQNQIFIGCAAVAD
FT                   YRVEQIAEQKIKKIPGNDEMVLKLVKNPDILATVANLMENRPFVVGFAAETQNVEQYAK
FT                   DKLQRKNLDMICANDVSGGQVFNSEQNALQLFWQNGQERLTLKHKSDLAKQLVDKIIVR
FT                   YKWKLEESK"
     MQNLIRGKRI VIGITGGIAA YKTIELIRLL RKAQAEVRVV LTNAATEFVT PLTLQAISGN        60
     AVSQSLLDHE AELAMGHIEL AKWADLIVIA PASADFIARM AVGMANDLLS TICLATNSPI       120
     FLAPAMNQQM YAQTVTQQNL AQLMARGVQF IGPNSGEQAC GDVGIGKMSE PFEIFTALCQ       180
     SFLHTQDLLD VSVVITAGPT REAIDPVRYI SNHSSGKMGF AIAEAFAQRG AKVTLISGPV       240
     NLATPHNVQR INVVSAQEMY QHAIQSAEQN QIFIGCAAVA DYRVEQIAEQ KIKKIPGNDE       300
     MVLKLVKNPD ILATVANLME NRPFVVGFAA ETQNVEQYAK DKLQRKNLDM ICANDVSGGQ       360
     VFNSEQNALQ LFWQNGQERL TLKHKSDLAK QLVDKIIVRY KWKLEESK                    408
//

If you have problems or comments...

PBIL Back to PBIL home page