(data stored in ACNUC7421 zone)

EMBL: CP000947.PE80

CP000947.PE80        Location/Qualifiers
FT   CDS             complement(90204..90935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0080"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: hso:HS_0211 amino
FT                   acid ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32472"
FT                   /db_xref="GOA:B0UV38"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV38"
FT                   /protein_id="ACA32472.1"
FT                   /translation="MVEISVLNNFLASLPFMTEARAELVINGFFPMVKAAVLVSIPLAI
FT                   VSFILGMVIAIAVALIRVSPSHSIIHRLFLFITKIYISIIRGTPMLVQISIVFYGLPAL
FT                   GIFIDPIPAAIIGFSLNVGAYASETVRAAIQSVPKGQWEAGYTIGMTYMQTFRRIIVPQ
FT                   AFRVAVPPLSNTFISLFKDTSLASVVTVTEMFRVAQQVANMSYDFLPVYIEAALIYWCF
FT                   CFILFLWQARIEKKLARYVTR"
     MVEISVLNNF LASLPFMTEA RAELVINGFF PMVKAAVLVS IPLAIVSFIL GMVIAIAVAL        60
     IRVSPSHSII HRLFLFITKI YISIIRGTPM LVQISIVFYG LPALGIFIDP IPAAIIGFSL       120
     NVGAYASETV RAAIQSVPKG QWEAGYTIGM TYMQTFRRII VPQAFRVAVP PLSNTFISLF       180
     KDTSLASVVT VTEMFRVAQQ VANMSYDFLP VYIEAALIYW CFCFILFLWQ ARIEKKLARY       240
     VTR                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page