(data stored in ACNUC7421 zone)

EMBL: CP000947.PE81

CP000947.PE81        Location/Qualifiers
FT   CDS             complement(90910..91692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0081"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: hso:HS_0212 amino acid ABC transporter,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32483"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV39"
FT                   /protein_id="ACA32483.1"
FT                   /translation="MLKKITFLFTTVFAIVANTQALAQASLLDRINNKGTITVGTEGTY
FT                   APFTYHDSTGKLTGYDVEVTRAVAKKLGVTVEFKETQWDAMLAGLKAGRFDLVANQVAL
FT                   TTPERQATFDKSEPYSWSGAMLVARDNETRIKQVEDVKGLKAAQTLSSNYGELAQKYQA
FT                   KIVPIDGMAQGLLLIQQKRADMTFNDALALLDYLKKYPNSGLKPVWESKDKVGAGLIVN
FT                   KNNDEALAKISAAIEELRNDGTLKQLGEQFFGRDISVK"
     MLKKITFLFT TVFAIVANTQ ALAQASLLDR INNKGTITVG TEGTYAPFTY HDSTGKLTGY        60
     DVEVTRAVAK KLGVTVEFKE TQWDAMLAGL KAGRFDLVAN QVALTTPERQ ATFDKSEPYS       120
     WSGAMLVARD NETRIKQVED VKGLKAAQTL SSNYGELAQK YQAKIVPIDG MAQGLLLIQQ       180
     KRADMTFNDA LALLDYLKKY PNSGLKPVWE SKDKVGAGLI VNKNNDEALA KISAAIEELR       240
     NDGTLKQLGE QFFGRDISVK                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page