(data stored in ACNUC7421 zone)

EMBL: CP000947.PE82

CP000947.PE82        Location/Qualifiers
FT   CDS             92084..92572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hso:HS_0218 Haemophilus-specific protein,
FT                   uncharacterized"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32494"
FT                   /db_xref="GOA:B0UV40"
FT                   /db_xref="InterPro:IPR025911"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV40"
FT                   /protein_id="ACA32494.1"
FT                   /translation="MTMNDKLKLYRVTDHYLDFLRDVEPKIPMNKDNGKKRPFVGIVLS
FT                   INGVKYIAPLSSKICKSQSDFKVKSGGEQKATIRFAYMFPIVDSALIEIDYTEEFKIDF
FT                   KYTALLIKEDLYINQHKARIHEIATKTYTNAITKRFGFENFCCDFAKLEEKHRAYEAQ"
     MTMNDKLKLY RVTDHYLDFL RDVEPKIPMN KDNGKKRPFV GIVLSINGVK YIAPLSSKIC        60
     KSQSDFKVKS GGEQKATIRF AYMFPIVDSA LIEIDYTEEF KIDFKYTALL IKEDLYINQH       120
     KARIHEIATK TYTNAITKRF GFENFCCDFA KLEEKHRAYE AQ                          162
//

If you have problems or comments...

PBIL Back to PBIL home page