(data stored in ACNUC7421 zone)

EMBL: CP000947.PE86

CP000947.PE86        Location/Qualifiers
FT   CDS             95866..96588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0086"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   hso:HS_0222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32534"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="InterPro:IPR041369"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV44"
FT                   /protein_id="ACA32534.1"
FT                   /translation="MSKFLLHLTPIAIIHTPYKEKFSVPRQANLVQDGTGIVELLPPFN
FT                   CPEAVRGLEQFSHLWLIFQFDNVPTGKWQPTVRPPRLGGNKRIGVFASRSTHRPNPLGL
FT                   SKVELREVEYKNGKILLHLGSVDLIDGTPILDIKPYIAYADNEPNARSGFAQEKPKQEL
FT                   RVEFSPEVQATLEKLEKKRPHLKRFIREVIQQDPRPAYQKGKCFHKIYGIALYEFNIRW
FT                   RIKNDDFTVAEVIEIQNI"
     MSKFLLHLTP IAIIHTPYKE KFSVPRQANL VQDGTGIVEL LPPFNCPEAV RGLEQFSHLW        60
     LIFQFDNVPT GKWQPTVRPP RLGGNKRIGV FASRSTHRPN PLGLSKVELR EVEYKNGKIL       120
     LHLGSVDLID GTPILDIKPY IAYADNEPNA RSGFAQEKPK QELRVEFSPE VQATLEKLEK       180
     KRPHLKRFIR EVIQQDPRPA YQKGKCFHKI YGIALYEFNI RWRIKNDDFT VAEVIEIQNI       240
//

If you have problems or comments...

PBIL Back to PBIL home page