(data stored in ACNUC7421 zone)

EMBL: CP000947.PE87

CP000947.PE87        Location/Qualifiers
FT   CDS             96870..98171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY2532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32545"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV45"
FT                   /protein_id="ACA32545.1"
FT                   /translation="MKRTILHALQKWKEKPNRKPLIIQGARQVGKTWVMKHFGEQAFAK
FT                   VAYINFDNNPRMKSLFAGDYDIQRLLLGLKIESGVDIQAEDTLIIFDEIQEAPQALSSL
FT                   KYFYENAPQFYIMAAGSLLGVSLHHQVSFPVGKVDFLPLYPMDFYEFLTALGKQDLVEL
FT                   LELQDWILISAMKSRYIDLLRQYYFVGGMPEAVKTFVQTQNLDEVRQVQRNLLMAYEQD
FT                   FSKHIQDGHTVQRVRALWHAIPEQLAKENKKFVYSLLQKGARSKDYELALQWLKDSGLV
FT                   HLVPRIKKPHLPLSAYQDGAFKLFGLDVGLLTAQTHLDKSVLLEGNRLFTEFKGALTEQ
FT                   YVLQQLIASQENPVFYWATERGTAEVDFVLQYKQAVIPIEVKAEENLKAKSLKVYVEQF
FT                   QSEKAIRFSMADYREQDWMVNVPLYVVKNMFFKI"
     MKRTILHALQ KWKEKPNRKP LIIQGARQVG KTWVMKHFGE QAFAKVAYIN FDNNPRMKSL        60
     FAGDYDIQRL LLGLKIESGV DIQAEDTLII FDEIQEAPQA LSSLKYFYEN APQFYIMAAG       120
     SLLGVSLHHQ VSFPVGKVDF LPLYPMDFYE FLTALGKQDL VELLELQDWI LISAMKSRYI       180
     DLLRQYYFVG GMPEAVKTFV QTQNLDEVRQ VQRNLLMAYE QDFSKHIQDG HTVQRVRALW       240
     HAIPEQLAKE NKKFVYSLLQ KGARSKDYEL ALQWLKDSGL VHLVPRIKKP HLPLSAYQDG       300
     AFKLFGLDVG LLTAQTHLDK SVLLEGNRLF TEFKGALTEQ YVLQQLIASQ ENPVFYWATE       360
     RGTAEVDFVL QYKQAVIPIE VKAEENLKAK SLKVYVEQFQ SEKAIRFSMA DYREQDWMVN       420
     VPLYVVKNMF FKI                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page