(data stored in ACNUC7421 zone)

EMBL: CP000947.PE89

CP000947.PE89        Location/Qualifiers
FT   CDS             98452..98871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0089"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: hso:HS_0223 high
FT                   affinity ribose transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32567"
FT                   /db_xref="GOA:B0UV47"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV47"
FT                   /protein_id="ACA32567.1"
FT                   /translation="MKKTKLLNASLSHYIATLGHTDSLVICDAGLPISNQVERVDLALE
FT                   AGVPGFLQTVDVVISEMFVEHAVVAKEIREKNPQIHDALLDSLRKLSEQQGNCIAVEYV
FT                   EHEEFKVLSSESKAAVRTGEFSPYANIILYSGVPF"
     MKKTKLLNAS LSHYIATLGH TDSLVICDAG LPISNQVERV DLALEAGVPG FLQTVDVVIS        60
     EMFVEHAVVA KEIREKNPQI HDALLDSLRK LSEQQGNCIA VEYVEHEEFK VLSSESKAAV       120
     RTGEFSPYAN IILYSGVPF                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page