(data stored in ACNUC7421 zone)

EMBL: CP000947.PE9

CP000947.PE9         Location/Qualifiers
FT   CDS             7321..7989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0009"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: hso:HS_0144 DNA
FT                   repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32578"
FT                   /db_xref="GOA:B0UUW7"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UUW7"
FT                   /protein_id="ACA32578.1"
FT                   /translation="MTQQNTTLMPREKLLKYGASSLDDKELLAIFLRTGIKNCPVMQLS
FT                   ELVLAHFSSLRGLINADQKHFCQMKGLGITQFVQLQACTEMTKRYLLQELQFAQEFTSP
FT                   DTVRMYLQTELENKDREIFMVLFLDNQHRLIKKEEMFLGTINQANVYPREIIKTALFCN
FT                   AAALILAHNHPSGVSTPSMADRKMTENIKQLSELMEIRVLDHFIIGKGNYFSFAEQGWI
FT                   "
     MTQQNTTLMP REKLLKYGAS SLDDKELLAI FLRTGIKNCP VMQLSELVLA HFSSLRGLIN        60
     ADQKHFCQMK GLGITQFVQL QACTEMTKRY LLQELQFAQE FTSPDTVRMY LQTELENKDR       120
     EIFMVLFLDN QHRLIKKEEM FLGTINQANV YPREIIKTAL FCNAAALILA HNHPSGVSTP       180
     SMADRKMTEN IKQLSELMEI RVLDHFIIGK GNYFSFAEQG WI                          222
//

If you have problems or comments...

PBIL Back to PBIL home page