(data stored in ACNUC7421 zone)

EMBL: CP000947.PE90

CP000947.PE90        Location/Qualifiers
FT   CDS             98892..100385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0090"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hin:HI0502 D-ribose transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32579"
FT                   /db_xref="GOA:B0UV48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV48"
FT                   /protein_id="ACA32579.1"
FT                   /translation="MQVETLLKITGVDKSFPGVKALSNACLSVYAGRAMALMGENGAGK
FT                   STLMKVLTGIYSKDSGSIEYLGDVVNFKGPKDSETAGISIIHQELNLVANLTVAENIFL
FT                   GREFTTSWGAIDWKKMYREADKLLAHLGVSFRSDQLCSELSIGEQQMVEIAKALSFKSK
FT                   VIIMDEPTDALTDTETETLFNVIRELKEQHCGIVYISHRIKEIFEICDDVTVLRDGQFI
FT                   GESAVQDLTEERLIEMMVGHRLEEQYPHVEQDRGSVRLEVNQLFGSGICDVSFKLYSGE
FT                   ILGVSGLMGAGRTELMKVLYGALPKEEGEVRLNNKVISNDSPQDGLRNGIVYISEDRKG
FT                   DGLILGMSVKENMSLTALDHLSKAGKINHQAEKMVVDDFIELFNIKTPNREQQIGLLSG
FT                   GNQQKVAVAKGLMTRPDVLILDEPTRGVDVGAKKEIYQLINKFKQEGLSIILVSSEMPE
FT                   VLGMSDRILVMHEGRISAEFSREEATQGKLLAAALGKHN"
     MQVETLLKIT GVDKSFPGVK ALSNACLSVY AGRAMALMGE NGAGKSTLMK VLTGIYSKDS        60
     GSIEYLGDVV NFKGPKDSET AGISIIHQEL NLVANLTVAE NIFLGREFTT SWGAIDWKKM       120
     YREADKLLAH LGVSFRSDQL CSELSIGEQQ MVEIAKALSF KSKVIIMDEP TDALTDTETE       180
     TLFNVIRELK EQHCGIVYIS HRIKEIFEIC DDVTVLRDGQ FIGESAVQDL TEERLIEMMV       240
     GHRLEEQYPH VEQDRGSVRL EVNQLFGSGI CDVSFKLYSG EILGVSGLMG AGRTELMKVL       300
     YGALPKEEGE VRLNNKVISN DSPQDGLRNG IVYISEDRKG DGLILGMSVK ENMSLTALDH       360
     LSKAGKINHQ AEKMVVDDFI ELFNIKTPNR EQQIGLLSGG NQQKVAVAKG LMTRPDVLIL       420
     DEPTRGVDVG AKKEIYQLIN KFKQEGLSII LVSSEMPEVL GMSDRILVMH EGRISAEFSR       480
     EEATQGKLLA AALGKHN                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page