(data stored in ACNUC7421 zone)

EMBL: CP000947.PE91

CP000947.PE91        Location/Qualifiers
FT   CDS             100395..101354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0091"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   hit:NTHI0631 ribose transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32590"
FT                   /db_xref="GOA:B0UV49"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV49"
FT                   /protein_id="ACA32590.1"
FT                   /translation="MKSSFKLGKMLLEQRSVIALLILIAIVSMINPDFFSIDNILNILR
FT                   QTSINAIIAVGMTFVILIAGIDLSVGSILALTGAVAASLVSMELSIFMVIPLTLLLGTF
FT                   LGSVSGFIVAKGKVQAFIATLVTMTLLRGVTMVYTEGRPISTGFSETADSFAYLGTGYL
FT                   LGIPLPIWLMVIVFAVAWYVLKHCKIGRYIYALGGNENATQLSGINVNRIKIFVFAVSG
FT                   FLSALAGLIVTARLSSAQPTAGVSYELDAIAAVVVGGTSLMGGKGRVMGTLIGALIIGF
FT                   LNNALNLLDVSSYYQMIAKALVILIAVLADNYLGNKKA"
     MKSSFKLGKM LLEQRSVIAL LILIAIVSMI NPDFFSIDNI LNILRQTSIN AIIAVGMTFV        60
     ILIAGIDLSV GSILALTGAV AASLVSMELS IFMVIPLTLL LGTFLGSVSG FIVAKGKVQA       120
     FIATLVTMTL LRGVTMVYTE GRPISTGFSE TADSFAYLGT GYLLGIPLPI WLMVIVFAVA       180
     WYVLKHCKIG RYIYALGGNE NATQLSGINV NRIKIFVFAV SGFLSALAGL IVTARLSSAQ       240
     PTAGVSYELD AIAAVVVGGT SLMGGKGRVM GTLIGALIIG FLNNALNLLD VSSYYQMIAK       300
     ALVILIAVLA DNYLGNKKA                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page