(data stored in ACNUC7421 zone)

EMBL: CP000947.PE92

CP000947.PE92        Location/Qualifiers
FT   CDS             101383..102261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0092"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: hit:NTHI0632
FT                   ribose-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32601"
FT                   /db_xref="GOA:B0UV50"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV50"
FT                   /protein_id="ACA32601.1"
FT                   /translation="MKKLTTIASAVMLSLAFSGVAMAKETIALAVSTLDNPFFVSLKDG
FT                   AQKKADELGYKLVVLDSQNDPAKELANVEDLMVRGAKVLLINPTDSEAVSNAVAIANRR
FT                   NVPVITLDRGAAKGKVVSHIASDNVAGGKMAGDFIAQKLGANAKVIQLEGIAGTSAARE
FT                   RGEGFKQAIAEHKFDVLASQPADFDRTKGLNVMENLLASKSAVQAVFAQNDEMALGALR
FT                   AINAANKKVLVVGFDGTDDGVKAVKSGKLGATIAQQPELIGSLGVETADKVLKGETVAE
FT                   KIPVDLKVIVK"
     MKKLTTIASA VMLSLAFSGV AMAKETIALA VSTLDNPFFV SLKDGAQKKA DELGYKLVVL        60
     DSQNDPAKEL ANVEDLMVRG AKVLLINPTD SEAVSNAVAI ANRRNVPVIT LDRGAAKGKV       120
     VSHIASDNVA GGKMAGDFIA QKLGANAKVI QLEGIAGTSA ARERGEGFKQ AIAEHKFDVL       180
     ASQPADFDRT KGLNVMENLL ASKSAVQAVF AQNDEMALGA LRAINAANKK VLVVGFDGTD       240
     DGVKAVKSGK LGATIAQQPE LIGSLGVETA DKVLKGETVA EKIPVDLKVI VK               292
//

If you have problems or comments...

PBIL Back to PBIL home page