(data stored in ACNUC7421 zone)

EMBL: CP000947.PE93

CP000947.PE93        Location/Qualifiers
FT   CDS             102345..103298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0093"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   KEGG: hso:HS_0225 ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32612"
FT                   /db_xref="GOA:B0UV51"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV51"
FT                   /protein_id="ACA32612.1"
FT                   /translation="MSKTLTVLGSINADHVISVPHFAKPGETLSGKQYHIAYGGKGANQ
FT                   AVAAARLADFSQGATVNFVGCIGSDDIGRAMKKAFAQDGINVATITEIPNEMTGIAMIQ
FT                   VADSGENSIVISAGANAYLTPEIVDKFATEIERADYLLMQLETPLNAILEAAKLAKKHG
FT                   ATVVLNPAPANQLPDELLSLLDMITPNETETEILTGVKVTDEQSAAKAASVLHQKGVAT
FT                   VLITLGSKGVYVSRKSSTQELGQNKVIAGFRVNAVDTTAAGDTFNGAFLTALLENKSLD
FT                   EAIRFAHAAAAISVTRQGAQPSIPTRRETLDFLAQH"
     MSKTLTVLGS INADHVISVP HFAKPGETLS GKQYHIAYGG KGANQAVAAA RLADFSQGAT        60
     VNFVGCIGSD DIGRAMKKAF AQDGINVATI TEIPNEMTGI AMIQVADSGE NSIVISAGAN       120
     AYLTPEIVDK FATEIERADY LLMQLETPLN AILEAAKLAK KHGATVVLNP APANQLPDEL       180
     LSLLDMITPN ETETEILTGV KVTDEQSAAK AASVLHQKGV ATVLITLGSK GVYVSRKSST       240
     QELGQNKVIA GFRVNAVDTT AAGDTFNGAF LTALLENKSL DEAIRFAHAA AAISVTRQGA       300
     QPSIPTRRET LDFLAQH                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page