(data stored in ACNUC7421 zone)

EMBL: CP000947.PE94

CP000947.PE94        Location/Qualifiers
FT   CDS             103319..104329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0094"
FT                   /product="Alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: hso:HS_0226
FT                   ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32623"
FT                   /db_xref="GOA:B0UV52"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV52"
FT                   /protein_id="ACA32623.1"
FT                   /translation="MATMKDIARIAQVSTSTVSHVINNSRFVSEEIRQKVMAVVEQLNY
FT                   TPSALARSLKVKETKTIGMLVTTSDNPFFAEVVASVERYCRQHHYHLILCNTNDDSICL
FT                   QENLQNLIRKQVDGLLLMCTDSAFETSPLNLTVPTVIMDWWPTELSADKIFEDSEQGGY
FT                   LATRTLIEHQHHDIAIITGNLKKPLARNRLKGYKQALQEYNIPIRDKWIIESHFNFEGG
FT                   IKGMEQLLQLKQRPSAVFACSDTIAVGAYQAVWRHGLSVPEDISIIGYDNIHLAQYLSP
FT                   PLSTVHQPKDEFAHLAVDTLLQRIKNPTESYRTLTLKPEIVLRQSICSCFLPKSA"
     MATMKDIARI AQVSTSTVSH VINNSRFVSE EIRQKVMAVV EQLNYTPSAL ARSLKVKETK        60
     TIGMLVTTSD NPFFAEVVAS VERYCRQHHY HLILCNTNDD SICLQENLQN LIRKQVDGLL       120
     LMCTDSAFET SPLNLTVPTV IMDWWPTELS ADKIFEDSEQ GGYLATRTLI EHQHHDIAII       180
     TGNLKKPLAR NRLKGYKQAL QEYNIPIRDK WIIESHFNFE GGIKGMEQLL QLKQRPSAVF       240
     ACSDTIAVGA YQAVWRHGLS VPEDISIIGY DNIHLAQYLS PPLSTVHQPK DEFAHLAVDT       300
     LLQRIKNPTE SYRTLTLKPE IVLRQSICSC FLPKSA                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page