(data stored in ACNUC7421 zone)

EMBL: CP000947.PE95

CP000947.PE95        Location/Qualifiers
FT   CDS             complement(104358..104771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0095"
FT                   /product="SmpA/OmlA domain protein"
FT                   /note="PFAM: SmpA/OmlA domain protein; KEGG: hso:HS_0227
FT                   conserved small protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32634"
FT                   /db_xref="GOA:B0UV53"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV53"
FT                   /protein_id="ACA32634.1"
FT                   /translation="MRLKFIIPAMILGLSVTACSSVQKIVYRIDVPQGNYLESTAVEQV
FT                   KVGMNAQQVQYLLGTPMLIDPFSNQTWYYVFLQQKSYNAPEQHTFIVNFDRRGIVTDVN
FT                   LDKPLPDVEKEYINNTIIQGPEAKRTSWWKFWR"
     MRLKFIIPAM ILGLSVTACS SVQKIVYRID VPQGNYLEST AVEQVKVGMN AQQVQYLLGT        60
     PMLIDPFSNQ TWYYVFLQQK SYNAPEQHTF IVNFDRRGIV TDVNLDKPLP DVEKEYINNT       120
     IIQGPEAKRT SWWKFWR                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page