(data stored in ACNUC7421 zone)

EMBL: CP000947.PE96

CP000947.PE96        Location/Qualifiers
FT   CDS             complement(104839..105852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0096"
FT                   /product="37kDa nucleoid-associated protein"
FT                   /note="PFAM: 37kDa nucleoid-associated protein; KEGG:
FT                   hso:HS_0228 possible nucleoid-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32645"
FT                   /db_xref="GOA:B0UV54"
FT                   /db_xref="InterPro:IPR007358"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV54"
FT                   /protein_id="ACA32645.1"
FT                   /translation="MSIIVNQIVLHQLVKTSQDENTVQLKTHLRDELLPITAETEQMML
FT                   QLHQEYQNKTKAYGVFQETSNFAQILNRTLENDIDFLAFSHQSAELLRQELGKYSFAND
FT                   GTLILCQYNFLATDYLFIALLDSRYSMLVDENLEIKQTHYLDITQFDIACRINLTELHL
FT                   DAKSTRYLTFIKGRVGRKIADFFMDFLGAEEGLNPQVQNQCLLQAVSDYCQQADLTKEQ
FT                   TQAVKKQVFDYCKGQINVGEEIVVTELSANIPTLNEQSFVDFAVSQNYGLEENIPPVRT
FT                   ALKSLTKFSGSGKGITLSFDAELLNSRIFWDEATDSLTITGLPPNLRDQLQRQTKE"
     MSIIVNQIVL HQLVKTSQDE NTVQLKTHLR DELLPITAET EQMMLQLHQE YQNKTKAYGV        60
     FQETSNFAQI LNRTLENDID FLAFSHQSAE LLRQELGKYS FANDGTLILC QYNFLATDYL       120
     FIALLDSRYS MLVDENLEIK QTHYLDITQF DIACRINLTE LHLDAKSTRY LTFIKGRVGR       180
     KIADFFMDFL GAEEGLNPQV QNQCLLQAVS DYCQQADLTK EQTQAVKKQV FDYCKGQINV       240
     GEEIVVTELS ANIPTLNEQS FVDFAVSQNY GLEENIPPVR TALKSLTKFS GSGKGITLSF       300
     DAELLNSRIF WDEATDSLTI TGLPPNLRDQ LQRQTKE                                337
//

If you have problems or comments...

PBIL Back to PBIL home page