(data stored in ACNUC7421 zone)

EMBL: CP000947.PE98

CP000947.PE98        Location/Qualifiers
FT   CDS             106193..107935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0098"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: hso:HS_0230 conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32665"
FT                   /db_xref="GOA:B0UV56"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012159"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024588"
FT                   /db_xref="UniProtKB/TrEMBL:B0UV56"
FT                   /protein_id="ACA32665.1"
FT                   /translation="MFGIKTSKQYRDELSRKITWGHWFAFFNILWAIVIGSRYAFIIDW
FT                   PHTLFGKIYFFISLLGHFSFIVFALYLLALFPLSFIIKNERTFRGISVILTTIGATLLL
FT                   VDTEVFSRFNLHLSTLVWNLLVNPDDGKLSYKWQIFFAPMPLILFVQMLFSRWAWYKLR
FT                   SLERQKWIKGVALVFVVSFIATHILYAWADAYIYRPITMQKSNFPLSYPMTARSFLEKH
FT                   GFLNKSEYEKTLNEQGRLDALKVNYPKQKLTFSDELPKTNIVLITISGLRHDAVRQDIM
FT                   PNLFAFSENSTDFTHHYSSGNSLNQGLTGLFYGLNANYADSLLSNKTTPVLIERLKQGK
FT                   VRYEIGLFGQNLSRSILLKKSIFANEKIRNDNNTSTRRFIEFVNTRQQQQKLFFAYLNY
FT                   SLNSNLTIEQYYQKLSEIDDEIGSAFKSIDFTHTIVIVTSEYGYSFDFSDKKRPTNYFA
FT                   REVIQVPMIIRWENLPIGKVNKLSSHTDLVPALMKHIFKVKNPISDFSQGQDLFDLDDN
FT                   RSWVLAGNYRWNVIITPDDSQYHIDRNGHYQKYNQHYQKISSTQPPLGLFLEVFSQNTA
FT                   FIEK"
     MFGIKTSKQY RDELSRKITW GHWFAFFNIL WAIVIGSRYA FIIDWPHTLF GKIYFFISLL        60
     GHFSFIVFAL YLLALFPLSF IIKNERTFRG ISVILTTIGA TLLLVDTEVF SRFNLHLSTL       120
     VWNLLVNPDD GKLSYKWQIF FAPMPLILFV QMLFSRWAWY KLRSLERQKW IKGVALVFVV       180
     SFIATHILYA WADAYIYRPI TMQKSNFPLS YPMTARSFLE KHGFLNKSEY EKTLNEQGRL       240
     DALKVNYPKQ KLTFSDELPK TNIVLITISG LRHDAVRQDI MPNLFAFSEN STDFTHHYSS       300
     GNSLNQGLTG LFYGLNANYA DSLLSNKTTP VLIERLKQGK VRYEIGLFGQ NLSRSILLKK       360
     SIFANEKIRN DNNTSTRRFI EFVNTRQQQQ KLFFAYLNYS LNSNLTIEQY YQKLSEIDDE       420
     IGSAFKSIDF THTIVIVTSE YGYSFDFSDK KRPTNYFARE VIQVPMIIRW ENLPIGKVNK       480
     LSSHTDLVPA LMKHIFKVKN PISDFSQGQD LFDLDDNRSW VLAGNYRWNV IITPDDSQYH       540
     IDRNGHYQKY NQHYQKISST QPPLGLFLEV FSQNTAFIEK                             580
//

If you have problems or comments...

PBIL Back to PBIL home page