(data stored in ACNUC7421 zone)

EMBL: CP000947.PE99

CP000947.PE99        Location/Qualifiers
FT   CDS             complement(108151..108867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HSM_0099"
FT                   /product="sugar fermentation stimulation protein"
FT                   /note="PFAM: sugar fermentation stimulation protein; KEGG:
FT                   hso:HS_0231 sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:HSM_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACA32676"
FT                   /db_xref="GOA:B0UV57"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0UV57"
FT                   /protein_id="ACA32676.1"
FT                   /translation="MQLPNLQSATLLRRYKRFLADVELNNGEILTLHCANTGAMTGCGE
FT                   KGDTVWFSTSDSKTRKYPHSWELTQLKNGQTVCINTHRSNQLTLEALQNKIITELAEYD
FT                   EILPEVKYGVENSRIDFLLKGKNLPDCYVEVKSVTFVKNHLGLFPDAVTTRGQKHLREL
FT                   IAMKKRGHRAVVFFAGLHDGFNRFTVAKSIDPDYAELLQQAVKEGVEVYSYAVKFDFSH
FT                   QKPTALYLTNLVSYLE"
     MQLPNLQSAT LLRRYKRFLA DVELNNGEIL TLHCANTGAM TGCGEKGDTV WFSTSDSKTR        60
     KYPHSWELTQ LKNGQTVCIN THRSNQLTLE ALQNKIITEL AEYDEILPEV KYGVENSRID       120
     FLLKGKNLPD CYVEVKSVTF VKNHLGLFPD AVTTRGQKHL RELIAMKKRG HRAVVFFAGL       180
     HDGFNRFTVA KSIDPDYAEL LQQAVKEGVE VYSYAVKFDF SHQKPTALYL TNLVSYLE         238
//

If you have problems or comments...

PBIL Back to PBIL home page