(data stored in ACNUC7421 zone)

EMBL: CP000948.AFUB

CP000948.AFUB        Location/Qualifiers
FT   CDS             complement(252142..252504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuB"
FT                   /locus_tag="ECDH10B_0249"
FT                   /product="CP4-6 prophage; predicted ferric trasnporter
FT                   subunit; membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01429"
FT                   /protein_id="ACB01429.1"
FT                   /translation="MESLPGQIDKSLDEASLSLRAGSLRTITHILLPLLRPAILSALIY
FT                   SFVRAITTVSAIVFLVTPDTRVATAYILNRVEDGEYGVAIAYGSILIVVMLAIIFIFDW
FT                   LIGESRTSRSKAKNQA"
     MESLPGQIDK SLDEASLSLR AGSLRTITHI LLPLLRPAIL SALIYSFVRA ITTVSAIVFL        60
     VTPDTRVATA YILNRVEDGE YGVAIAYGSI LIVVMLAIIF IFDWLIGESR TSRSKAKNQA       120
//

If you have problems or comments...

PBIL Back to PBIL home page