(data stored in ACNUC7421 zone)

EMBL: CP000948.AFUC

CP000948.AFUC        Location/Qualifiers
FT   CDS             complement(251084..252130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="afuC"
FT                   /locus_tag="ECDH10B_0248"
FT                   /product="CP4-6 prophage; predicted ferric transporter
FT                   subunit; ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01428"
FT                   /protein_id="ACB01428.1"
FT                   /translation="MTQKNFVELRNVTKRFGSNTVIDNINLTIPQGQMVTLLGPSGCGK
FT                   TTILRLVAGLEKPSEGQIFIDGEDVTHRSIQQRDICMVFQSYALFPHMSLGENVGYGLK
FT                   MLGVPRAELKARVKEALAMVDLEGFEDRFVDQISGGQQQRVALARALILKPKVLLFDEP
FT                   LSNLDANLRRSMRDKIRELQKQFDITSLYVTHDQSEAFAVSDTVLVMNKGHIMQIGSPQ
FT                   DLYRQPASRFMASFMGDANLFPATFSDGYVDIYGYHLPRPLHFGTQGEGMVGVRPEAIT
FT                   LSDRGEESQRCVIRHVAYMGPQYEVTVEWHGQEILLQVNATRLQPDVGEQYYLEIHPYG
FT                   MFVLADAA"
     MTQKNFVELR NVTKRFGSNT VIDNINLTIP QGQMVTLLGP SGCGKTTILR LVAGLEKPSE        60
     GQIFIDGEDV THRSIQQRDI CMVFQSYALF PHMSLGENVG YGLKMLGVPR AELKARVKEA       120
     LAMVDLEGFE DRFVDQISGG QQQRVALARA LILKPKVLLF DEPLSNLDAN LRRSMRDKIR       180
     ELQKQFDITS LYVTHDQSEA FAVSDTVLVM NKGHIMQIGS PQDLYRQPAS RFMASFMGDA       240
     NLFPATFSDG YVDIYGYHLP RPLHFGTQGE GMVGVRPEAI TLSDRGEESQ RCVIRHVAYM       300
     GPQYEVTVEW HGQEILLQVN ATRLQPDVGE QYYLEIHPYG MFVLADAA                    348
//

If you have problems or comments...

PBIL Back to PBIL home page