(data stored in ACNUC7421 zone)

EMBL: CP000948.AHPC

CP000948.AHPC        Location/Qualifiers
FT   CDS             577500..578063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="ECDH10B_0566"
FT                   /product="alkyl hydroperoxide reductase, C22 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01729"
FT                   /protein_id="ACB01729.1"
FT                   /translation="MSLINTKIKPFKNQAFKNGEFIEITEKDTEGRWSVFFFYPADFTF
FT                   VCPTELGDVADHYEELQKLGVDVYAVSTDTHFTHKAWHSSSETIAKIKYAMIGDPTGAL
FT                   TRNFDNMREDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDLLRKIKAAQYVASHPG
FT                   EVCPAKWKEGEATLAPSLDLVGKI"
     MSLINTKIKP FKNQAFKNGE FIEITEKDTE GRWSVFFFYP ADFTFVCPTE LGDVADHYEE        60
     LQKLGVDVYA VSTDTHFTHK AWHSSSETIA KIKYAMIGDP TGALTRNFDN MREDEGLADR       120
     ATFVVDPQGI IQAIEVTAEG IGRDASDLLR KIKAAQYVAS HPGEVCPAKW KEGEATLAPS       180
     LDLVGKI                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page